KEGG   Rattus norvegicus (rat): 24626Help
Entry
24626             CDS       T01003                                 

Gene name
Pde4b, PDE4/IVb, Pde4B1, Pde4B2, Pde4B3, Pde4B4
Definition
(RefSeq) phosphodiesterase 4B (EC:3.1.4.53)
  KO
K13293  
cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
rno  Rattus norvegicus (rat)
Pathway
Purine metabolism
cAMP signaling pathway
Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    24626 (Pde4b)
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    24626 (Pde4b)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    24626 (Pde4b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     24626 (Pde4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q32
AA seq 721 aa AA seqDB search
MTAKNSSKELPASESEVCIKTFKEQMRLELELPKLPGNRPTSPKISPRSSPRNSPCFFRK
LLVNKSIRQRRRFTVAHTCFDVENGPSPGRSPLDPQASSSSGLVLHAAFPGHSQRRESFL
YRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRIVRNNFTLLTNLHGAPNK
RSPAASQAPVTRVSLQEESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLN
RELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLM
HSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSHNRPLTCIMYAIFQER
DLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVFTDLE
ILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIF
QNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQV
LRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQ
VGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDERSRDCQGLM
EKFQFELTLEEEDSEGPEKEGEGPNYFSSTKTLCVIDPENRDSLEETDIDIATEDKSLID
T
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaaaattcttccaaagaacttccagcttctgaatctgaggtttgcataaag
actttcaaggagcagatgcgcttggaacttgagcttccaaagctaccaggaaacagacct
acatctcccaaaatttctccacgcagttcaccaaggaattcaccatgctttttcagaaag
ttgctggtgaataaaagcatccgacagcggcgtcgcttcactgtggctcatacatgcttt
gatgtggaaaatggcccttctccaggtcggagcccactggaccctcaagccagctcttct
tcaggactggtacttcatgccgccttccctgggcacagccaacgcagagagtcttttctc
tacagatccgacagcgactatgacttgtcaccaaaagcgatgtcaaggaactcctcactt
cccagcgaacaacacggcgatgacctgattgtcactccttttgcccaggttcttgccagc
ttgcgaatcgtaagaaacaatttcaccctgctgacaaaccttcacggagcaccgaacaag
aggtcgccagcggctagtcaggctccagtcaccagagtcagcctgcaagaagaatcatat
cagaaactagcaatggagacgctggaggaactagactggtgcctagaccagctagagacc
atccagacctaccgctctgtcagcgagatggcttcaaacaagttcaaaaggatgctgaac
cgggagctgacacacctctcagagatgagcagatcagggaaccaagtgtctgaatacatt
tcgaacacgttcttagacaagcagaacgatgtggaaatcccatctcccacccagaaggac
agggagaagaagaagaagcagcagctcatgacccagataagtggagtgaagaaactgatg
cacagctcaagcctgaacaacacaagcatctcacgctttggagtcaacacggaaaatgag
gatcatctagccaaggagctggaagacctgaacaaatggggccttaacatcttcaacgtg
gctgggtactcccataatcggcccctcacatgcatcatgtacgccattttccaggaaaga
gaccttctaaagacgtttaaaatctcctccgacaccttcgtaacctacatgatgacttta
gaagaccattaccattctgatgtggcgtatcacaacagcctgcacgctgctgacgtggcc
cagtcaacgcacgttctcctctctacgccagcactggatgctgtcttcacagacctggaa
atcctggctgccatttttgcagctgccatccatgatgttgatcatcctggagtctccaat
cagtttctcatcaatacaaattccgaacttgctttgatgtataatgacgaatctgtgctg
gaaaaccatcacctcgctgtgggattcaagctccttcaagaggaacattgcgacatcttt
cagaatcttaccaagaagcaacgccagacactcaggaaaatggtgattgacatggtgtta
gcaactgatatgtccaagcacatgagcctcctggctgaccttaaaacgatggtagaaacc
aaaaaggtgacgagctccggtgttctcctcctggacaactatactgaccggatacaggtt
cttcgcaacatggtacattgtgcagacctgagcaaccctaccaagtccttggagttgtat
cggcaatggactgatcgcatcatggaggagtttttccaacagggagacaaagaacgggag
aggggaatggagattagcccaatgtgtgataaacacacagcttctgtggaaaagtcccag
gttggtttcattgactacattgtccatccattgtgggagacctgggcagacctggttcag
cctgatgctcaagacattttggacacactagaagataacaggaactggtaccagagtatg
attccccagagcccctctccaccactggacgagaggagcagggactgccaaggccttatg
gagaagtttcagttcgaactgacccttgaagaagaggattctgaaggaccggaaaaggag
ggagaaggccccaactatttcagcagcacaaagacactttgtgtgatcgatccagagaac
agggattctctggaagagactgacatagacattgccacagaagacaagtctctgatcgac
acataa

DBGET integrated database retrieval system