KEGG   Rattus norvegicus (rat): 246266Help
Entry
246266            CDS       T01003                                 

Gene name
Aspg
Definition
asparaginase (EC:3.1.1.5 3.1.1.47 3.5.1.1)
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     246266 (Aspg)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     246266 (Aspg)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     246266 (Aspg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q32
AA seq 564 aa AA seqDB search
MARATGPEQRLLAIYTGGTIGMRSEGGVLVPGRGLAAVLRTLHMLHDEEYARAHSLPEDT
LVLPPASSDQRIIYKVLECQPLFDSSDMTITEWVQIAQTIERHYTQYQGFVVIHGTDTMA
FAASVLSFMLENLQKPVILTGAQVPIHELWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKASWKSHLVVHSNMEPDVGL
LRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLIQELRAAAERGLIIVNCTHCL
QGAVTSDYAPGMAMAGAGIISGFDMTSEAALAKLSYVLGQPGLSLSDRKKLLAKDLRGEM
TLPTTDDLLGDDMLGCRATWLLSMNGSQDADAMKDVLLPGLALAAAHAGDLDTLQAFVEL
GRDLNLKDYSGQTPLHVAARRGHASVVAMLLQKGVDVDACNEDGQSPLLLAVRGRHQSVI
RLLRAAGAHLSPQELEDVGTELCRLASRADSEGLRAWWQAGADLGQPDYDGHCALQVAEA
AGNADVVALLQSLEDRVSAQPQPH
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtgctaccggacccgagcagcggctgctggccatctacactggcggcaccatc
ggcatgcggagtgaaggcggagtgctggtacctgggagaggcctggctgctgtcctgagg
acacttcacatgctccacgatgaagagtatgccagagcccacagcctgcccgaggatacg
ctggtgttgcccccggccagttctgaccagaggatcatctacaaggtgctggagtgccag
ccactcttcgactccagtgacatgaccatcactgaatgggttcagattgcccaaacgata
gagagacactacacacagtaccagggctttgtggtcatccacggcacggacaccatggcc
tttgctgcgtcagtgctctctttcatgctggaaaacctgcagaaaccggtcatcctcaca
ggtgcccaggttcctatccacgaactgtggagtgatggccgtgagaacctgctgggggct
ctgctcatggctggccagtacgtcatccctgaggtctgcctgttcttccagaatcagctc
tttcggggcaatcggacaaccaaggtggacgctcggagatttgcggccttctgctcccct
aacctgccccctctagccactgtgggcgcagacgtaacaatcaaccgtgagctggtacgg
aaggccagttggaagagccacctggtggtccacagcaacatggagcctgatgtgggccta
ctgcgcctctaccctgggattcccgcctccctggtccggaccttcctccagcccccactg
aagggcgtggtcatggagacctttggctccgggaatgggcccaccaagccggacctaata
caggagctccgggcggcggccgaaagaggcctgatcattgtcaactgtacccattgcctt
cagggggctgtgacttccgactatgcacctgggatggccatggcaggagccggcataatc
tcaggcttcgacatgacatcagaagctgccctggccaaactgtcctatgtgctgggccag
ccagggctgagcctgagtgacaggaagaagctgctggccaaggatcttcgcggggagatg
acactgcctacaacagatgacttgctgggagatgacatgctgggctgcagggccacatgg
cttctcagtatgaatggcagccaggatgccgatgccatgaaggatgttctgctgcccggc
ctggccctggctgcagctcatgctggtgacctggacactctgcaggcctttgtggagctg
ggcagagacctcaacctgaaggactacagtggccagacgccactgcatgtggctgcacgg
agagggcatgcttcagtggtcgccatgctactgcagaagggtgtggatgtggatgcctgt
aatgaggacggtcagagcccactgctgctggccgtgaggggcaggcatcagagtgtcatc
aggctgctgagggccgctggggctcacctgtctccccaggagctggaggacgtggggaca
gagctgtgcaggctggcatcaagggcggacagcgaaggcctgcgggcgtggtggcaggct
ggggctgacctaggacagccggactatgatggacactgtgccctgcaagttgctgaagca
gcagggaatgcagatgtggtggctctgctgcagagtcttgaggacagggtcagcgcccag
ccccagccccattag

DBGET integrated database retrieval system