KEGG   Rattus norvegicus (rat): 246267Help
Entry
246267            CDS       T01003                                 

Definition
resection-induced TPI (rs11)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rno01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rno01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rno00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rno00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:rno00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
AA seq 254 aa AA seqDB search
MSARRPVVGGNFKCNGDFAFIKTHTEVLKTIPKNNVEVYVAPSAIHLKTLADNLKGTHIE
VAAQNVYYEKPGAWTGELNVEMLLDCGLKTVIIGHSERRRIMGETNEQSAKKAARAISLG
MTVAFCIGETLEERNAGKVDEVNFAQLEALRAVLKEADWKNVIIAYEPVWSIGTGVVASP
EQAQEVHASIRKWLGEKVSKAVADATRIQYGGSVNAANCAALGKCPDIDGFLVGGASLKP
EFVQIVTTLGDVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgtcgccctgttgtaggtggtaacttcaagtgcaatggtgatttcgccttc
atcaagactcacaccgaggtcttgaagacgatcccaaagaacaatgttgaagtttacgtt
gctccttctgcaatccacttgaaaactcttgccgacaaccttaagggtactcacatcgag
gttgctgctcagaacgtttactatgagaagcctggcgcatggactggtgagttgaacgtt
gaaatgctgcttgattgcggcctgaagactgtcatcattggtcactctgagagacgtcgt
atcatgggtgaaactaacgaacaatctgctaaaaaggctgctcgtgctatctcccttggc
atgactgttgctttctgcattggtgagactcttgaggaaagaaacgctggcaaagttgac
gaggttaacttcgctcagctcgaggctcttcgtgccgttctgaaagaagctgactggaag
aacgtcatcattgcttatgaacctgtttggtctatcggtactggtgtcgttgcctcacct
gaacaagctcaggaggttcacgcttccatcagaaagtggctcggtgagaaggtttccaag
gctgttgctgatgccacccgtatccaatatggtggttccgtcaacgctgctaactgcgcc
gctcttggcaagtgcccagatatcgatggtttccttgttggtggtgcttccctcaagcca
gagttcgtccagatcgtcactactctcggtgatgtcaagaaatga

DBGET integrated database retrieval system