KEGG   Rattus norvegicus (rat): 246267Help
Entry
246267            CDS       T01003                                 

Definition
resection-induced TPI (rs11)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    246267
   01230 Biosynthesis of amino acids
    246267
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    246267
   00051 Fructose and mannose metabolism
    246267
   00562 Inositol phosphate metabolism
    246267
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     246267
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   246267
  Exosomal proteins of bladder cancer cells
   246267
  Exosomal proteins of melanoma cells
   246267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
AA seq 254 aa AA seqDB search
MSARRPVVGGNFKCNGDFAFIKTHTEVLKTIPKNNVEVYVAPSAIHLKTLADNLKGTHIE
VAAQNVYYEKPGAWTGELNVEMLLDCGLKTVIIGHSERRRIMGETNEQSAKKAARAISLG
MTVAFCIGETLEERNAGKVDEVNFAQLEALRAVLKEADWKNVIIAYEPVWSIGTGVVASP
EQAQEVHASIRKWLGEKVSKAVADATRIQYGGSVNAANCAALGKCPDIDGFLVGGASLKP
EFVQIVTTLGDVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgtcgccctgttgtaggtggtaacttcaagtgcaatggtgatttcgccttc
atcaagactcacaccgaggtcttgaagacgatcccaaagaacaatgttgaagtttacgtt
gctccttctgcaatccacttgaaaactcttgccgacaaccttaagggtactcacatcgag
gttgctgctcagaacgtttactatgagaagcctggcgcatggactggtgagttgaacgtt
gaaatgctgcttgattgcggcctgaagactgtcatcattggtcactctgagagacgtcgt
atcatgggtgaaactaacgaacaatctgctaaaaaggctgctcgtgctatctcccttggc
atgactgttgctttctgcattggtgagactcttgaggaaagaaacgctggcaaagttgac
gaggttaacttcgctcagctcgaggctcttcgtgccgttctgaaagaagctgactggaag
aacgtcatcattgcttatgaacctgtttggtctatcggtactggtgtcgttgcctcacct
gaacaagctcaggaggttcacgcttccatcagaaagtggctcggtgagaaggtttccaag
gctgttgctgatgccacccgtatccaatatggtggttccgtcaacgctgctaactgcgcc
gctcttggcaagtgcccagatatcgatggtttccttgttggtggtgcttccctcaagcca
gagttcgtccagatcgtcactactctcggtgatgtcaagaaatga

DBGET integrated database retrieval system