KEGG   Rattus norvegicus (rat): 24642Help
Entry
24642             CDS       T01003                                 

Gene name
Pgam1, Pgmut
Definition
phosphoglycerate mutase 1 (brain) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    24642 (Pgam1)
   01230 Biosynthesis of amino acids
    24642 (Pgam1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    24642 (Pgam1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    24642 (Pgam1)
Enzymes [BR:rno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     24642 (Pgam1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   24642 (Pgam1)
  Exosomal proteins of melanoma cells
   24642 (Pgam1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDIVFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKG
VLIPAHGNSYGGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQSLGDEETVR
KAMEAVAAQGKVKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctacaagctggtgctgatccggcatggcgagagcgcctggaacctggagaac
cgcttcagcggctggtacgatgccgacctgagcccagcgggccacgaggaggcgaagcgc
ggcgggcaggcgttgcgagatgctggctatgagtttgacatcgtcttcacctctgtgcag
aagagagcaatccgcaccctctggacagtcctggatgccattgaccagatgtggttgcca
gtggtacggacctggcgtctcaatgagcgacactatgggggactaacaggtctcaataaa
gcagagactgctgctaagcatggtgaggcacaggtaaagatctggagacgatcttacgat
gtcccgccacctccaatggagcctgatcatcccttctacagcaacatcagcaaggaccgc
aggtacgcagaccttactgaggaccagctaccctcctgtgagagcctgaaggatactatt
gccagggcactgcccttctggaatgaagaaattgttccccagatcaaggaggggaaaggg
gtcttgattcctgcccatggcaacagctacgggggcattgtcaagcatctggagggtctg
tcagaagaggccatcatggagctgaacctgccaactggtatacccatcgtctatgaactg
gacaagaacttgaagcccatcaagcccatgcagtctctgggagatgaagagacggtgcgt
aaagccatggaagctgtggctgctcagggcaaggtgaagaagtga

DBGET integrated database retrieval system