KEGG   Rattus norvegicus (rat): 24668Help
Entry
24668             CDS       T01003                                 

Gene name
Ppp1ca
Definition
protein phosphatase 1, catalytic subunit, alpha isozyme (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
mRNA surveillance pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Hippo signaling pathway
Focal adhesion
Platelet activation
Long-term potentiation
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Regulation of actin cytoskeleton
Insulin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Alcoholism
Herpes simplex infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    24668 (Ppp1ca)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    24668 (Ppp1ca)
   04022 cGMP - PKG signaling pathway
    24668 (Ppp1ca)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    24668 (Ppp1ca)
  Cell growth and death
   04114 Oocyte meiosis
    24668 (Ppp1ca)
  Cell communication
   04510 Focal adhesion
    24668 (Ppp1ca)
 Organismal Systems
  Immune system
   04611 Platelet activation
    24668 (Ppp1ca)
  Endocrine system
   04910 Insulin signaling pathway
    24668 (Ppp1ca)
   04921 Oxytocin signaling pathway
    24668 (Ppp1ca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24668 (Ppp1ca)
   04270 Vascular smooth muscle contraction
    24668 (Ppp1ca)
  Nervous system
   04728 Dopaminergic synapse
    24668 (Ppp1ca)
   04720 Long-term potentiation
    24668 (Ppp1ca)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24668 (Ppp1ca)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    24668 (Ppp1ca)
  Substance dependence
   05031 Amphetamine addiction
    24668 (Ppp1ca)
   05034 Alcoholism
    24668 (Ppp1ca)
  Infectious diseases
   05168 Herpes simplex infection
    24668 (Ppp1ca)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24668 (Ppp1ca)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     24668 (Ppp1ca)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     24668 (Ppp1ca)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    24668 (Ppp1ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggattccatcatcgggcgcctgctggaagtgcag
ggctcacggcctggaaagaatgtgcagctgacagagaacgagatccgtggtctttgcctc
aaatcccgggagattttcctgagccagcctattcttctggagcttgaggcgcctctcaag
atctgtggtgacatccatggccagtactatgaccttctacggctgttcgagtatggtggc
ttccctccagagagcaactacctcttcttgggggactatgtggatcggggaaagcagtct
ttggagaccatctgcttgttgctggcctataagatcaaatacccggagaatttctttcta
ctacgtgggaaccatgagtgtgccagcatcaaccgcatctatggcttctatgatgaatgc
aagagacgatacaacatcaaactgtggaagactttcaccgactgcttcaactgcctgccc
attgcagccattgtagatgagaagatcttctgctgccacggaggcctgtctccagacttg
caatccatggagcagattagacgtattatgcggcccacggacgtgcctgaccagggcctg
ttgtgtgatctgctgtggtctgaccctgacaaggatgttcaaggctggggcgagaatgac
cgtggagtctcctttacctttggggccgaggttgtagccaagttcctgcacaagcatgat
ttggacctcatctgcagagcacatcaggttgtagaagatggctatgagttctttgccaag
aggcagctggtgacactcttctcagctcccaactactgtggcgagtttgacaacgctggc
gccatgatgagtgtggacgagacactcatgtgttccttccagatcctcaagcccgctgat
aagaataaggggaagtatgggcagttcagtggcctgaaccccggaggccgtcccatcact
ccaccccgcaattctgccaaagccaagaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system