KEGG   Rattus norvegicus (rat): 24668Help
Entry
24668             CDS       T01003                                 

Gene name
Ppp1ca, PP1alpha
Definition
(RefSeq) protein phosphatase 1 catalytic subunit alpha
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03015  mRNA surveillance pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04611  Platelet activation
rno04720  Long-term potentiation
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04810  Regulation of actin cytoskeleton
rno04910  Insulin signaling pathway
rno04921  Oxytocin signaling pathway
rno04931  Insulin resistance
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05168  Herpes simplex infection
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    24668 (Ppp1ca)
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    24668 (Ppp1ca)
   04024 cAMP signaling pathway
    24668 (Ppp1ca)
   04022 cGMP - PKG signaling pathway
    24668 (Ppp1ca)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    24668 (Ppp1ca)
   04218 Cellular senescence
    24668 (Ppp1ca)
  Cellular community - eukaryotes
   04510 Focal adhesion
    24668 (Ppp1ca)
  Cell motility
   04810 Regulation of actin cytoskeleton
    24668 (Ppp1ca)
 Organismal Systems
  Immune system
   04611 Platelet activation
    24668 (Ppp1ca)
  Endocrine system
   04910 Insulin signaling pathway
    24668 (Ppp1ca)
   04921 Oxytocin signaling pathway
    24668 (Ppp1ca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24668 (Ppp1ca)
   04270 Vascular smooth muscle contraction
    24668 (Ppp1ca)
  Nervous system
   04728 Dopaminergic synapse
    24668 (Ppp1ca)
   04720 Long-term potentiation
    24668 (Ppp1ca)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24668 (Ppp1ca)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    24668 (Ppp1ca)
  Substance dependence
   05031 Amphetamine addiction
    24668 (Ppp1ca)
   05034 Alcoholism
    24668 (Ppp1ca)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    24668 (Ppp1ca)
  Infectious diseases
   05168 Herpes simplex infection
    24668 (Ppp1ca)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     24668 (Ppp1ca)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     24668 (Ppp1ca)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     24668 (Ppp1ca)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     24668 (Ppp1ca)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    24668 (Ppp1ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 24668
NCBI-ProteinID: NP_113715
RGD: 3375
Ensembl: ENSRNOG00000018708
UniProt: P62138
Position
1q43
AA seq 330 aa AA seqDB search
MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KNKGKYGQFSGLNPGGRPITPPRNSAKAKK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcgagaagctcaacctggattccatcatcgggcgcctgctggaagtgcag
ggctcacggcctggaaagaatgtgcagctgacagagaacgagatccgtggtctttgcctc
aaatcccgggagattttcctgagccagcctattcttctggagcttgaggcgcctctcaag
atctgtggtgacatccatggccagtactatgaccttctacggctgttcgagtatggtggc
ttccctccagagagcaactacctcttcttgggggactatgtggatcggggaaagcagtct
ttggagaccatctgcttgttgctggcctataagatcaaatacccggagaatttctttcta
ctacgtgggaaccatgagtgtgccagcatcaaccgcatctatggcttctatgatgaatgc
aagagacgatacaacatcaaactgtggaagactttcaccgactgcttcaactgcctgccc
attgcagccattgtagatgagaagatcttctgctgccacggaggcctgtctccagacttg
caatccatggagcagattagacgtattatgcggcccacggacgtgcctgaccagggcctg
ttgtgtgatctgctgtggtctgaccctgacaaggatgttcaaggctggggcgagaatgac
cgtggagtctcctttacctttggggccgaggttgtagccaagttcctgcacaagcatgat
ttggacctcatctgcagagcacatcaggttgtagaagatggctatgagttctttgccaag
aggcagctggtgacactcttctcagctcccaactactgtggcgagtttgacaacgctggc
gccatgatgagtgtggacgagacactcatgtgttccttccagatcctcaagcccgctgat
aagaataaggggaagtatgggcagttcagtggcctgaaccccggaggccgtcccatcact
ccaccccgcaattctgccaaagccaagaaatag

DBGET integrated database retrieval system