KEGG   Rattus norvegicus (rat): 246767Help
Entry
246767            CDS       T01003                                 

Gene name
Cyp4x1
Definition
cytochrome P450, family 4, subfamily x, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    246767 (Cyp4x1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     246767 (Cyp4x1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP4 family
   246767 (Cyp4x1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 507 aa AA seqDB search
MEASWLENRWARPLHLALVFCLALVLMQAVKLYLRRQRLLRDLRPFPGPTAHWLLGHQKF
LQEDNMEKLDEIVKEYPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKTQYLHQLMTPF
LGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEV
FEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKL
SPKGHCFQELGKVIHQCTEKIIQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFS
DADLRSEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLD
EIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKD
PKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRFRVAADLT
RPPAFSSHTVLRPKHGIYLHLKKLPEC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctcctggctggagaatcgctgggcgcggcccttacacctggctttggtgttc
tgcctggcgctggtgctgatgcaggccgtgaagctctacctgagaagacagaggctgctg
cgcgacctacgccccttcccgggtcctaccgcccactggctcctgggacaccagaagttt
cttcaggaggataatatggagaagcttgacgagattgtcaaagagtacccttgcgccttc
ccctgctgggtaggacccttccaagcatttttctacatctatgacccagactatgcaaag
atttttctgagcagaacagacccaaagacccagtacctgcaccagctcatgactcccttt
cttggaagaggactcctgaatttagatgggcccaggtggttccaacaccgctgcctcctg
actcctgcgttccatcaggacatcctaaaaccatgtgtggacatgatggcccactctgtg
aacatgatgctggataaatgggagaagacgtggaccacgcaggaaacaaccatcgaggtt
tttgaacacattaacttgatgaccctggacataataatgaaatgtgcttttggccaggag
accaactgccagataaacggcacctatgagtcttatgtgaaggcaacatttgaacttggt
gaaatcatatcttctcgcttgtacaatttctggcatcatcatgacataattttcaaactc
agtcctaagggccactgcttccaggagttaggcaaagtgatacatcaatgcacagaaaag
attatccaggacagaaagaaaaccctcaaggatcaagtaaatcaggatgacactcaaaca
tctcaaaattttctggatattgttctttctgcccaggctggagatgaaaaggccttctca
gatgctgaccttcggtctgaggtgaacaccttcatgtgggcaggacacgacgcctctgca
gctagcatctcctggctcctttactgcctggctctgaaccctgagcatcaagacagatgc
cggacagagatcaggagcattctgggagatgggtcttccatcacctgggaacagctggat
gagataccttacactacaatgtgcatcaaggagacactccgcttgattcctcccatccca
tccatctccagggaactcagcaaaccccttaccctcccagatggacactcgctgcctgca
ggaatgactgtggtccttagtatttggggtctccaccacaatcctgctgtctggaaagac
ccaaaggtctttgaccctttgagattcactaaggagaattctgaacagagacacccctgc
gccttcctaccattctccagtggtccaaggaactgcatcgggcagcagtttgccatgctg
gagttaaaggtggccattgccttgactctgctccgcttccgagtagctgcagacctcacc
aggcctcctgccttctccagccacactgtgctcagacccaagcatgggatctatttgcac
ctgaagaaactccctgaatgttag

DBGET integrated database retrieval system