KEGG   Rattus norvegicus (rat): 246767Help
Entry
246767            CDS       T01003                                 

Gene name
Cyp4x1
Definition
cytochrome P450, family 4, subfamily x, polypeptide 1 (EC:1.14.14.1)
Orthology
K07428  
cytochrome P450, family 4, subfamily X [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Serotonergic synapse
Class
Organismal Systems; Nervous system; Serotonergic synapse [PATH:rno04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 507 aa AA seqDB search
MEASWLENRWARPLHLALVFCLALVLMQAVKLYLRRQRLLRDLRPFPGPTAHWLLGHQKF
LQEDNMEKLDEIVKEYPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKTQYLHQLMTPF
LGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEV
FEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKL
SPKGHCFQELGKVIHQCTEKIIQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFS
DADLRSEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLD
EIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKD
PKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRFRVAADLT
RPPAFSSHTVLRPKHGIYLHLKKLPEC
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggaggcctcctggctggagaatcgctgggcgcggcccttacacctggctttggtgttc
tgcctggcgctggtgctgatgcaggccgtgaagctctacctgagaagacagaggctgctg
cgcgacctacgccccttcccgggtcctaccgcccactggctcctgggacaccagaagttt
cttcaggaggataatatggagaagcttgacgagattgtcaaagagtacccttgcgccttc
ccctgctgggtaggacccttccaagcatttttctacatctatgacccagactatgcaaag
atttttctgagcagaacagacccaaagacccagtacctgcaccagctcatgactcccttt
cttggaagaggactcctgaatttagatgggcccaggtggttccaacaccgctgcctcctg
actcctgcgttccatcaggacatcctaaaaccatgtgtggacatgatggcccactctgtg
aacatgatgctggataaatgggagaagacgtggaccacgcaggaaacaaccatcgaggtt
tttgaacacattaacttgatgaccctggacataataatgaaatgtgcttttggccaggag
accaactgccagataaacggcacctatgagtcttatgtgaaggcaacatttgaacttggt
gaaatcatatcttctcgcttgtacaatttctggcatcatcatgacataattttcaaactc
agtcctaagggccactgcttccaggagttaggcaaagtgatacatcaatgcacagaaaag
attatccaggacagaaagaaaaccctcaaggatcaagtaaatcaggatgacactcaaaca
tctcaaaattttctggatattgttctttctgcccaggctggagatgaaaaggccttctca
gatgctgaccttcggtctgaggtgaacaccttcatgtgggcaggacacgacgcctctgca
gctagcatctcctggctcctttactgcctggctctgaaccctgagcatcaagacagatgc
cggacagagatcaggagcattctgggagatgggtcttccatcacctgggaacagctggat
gagataccttacactacaatgtgcatcaaggagacactccgcttgattcctcccatccca
tccatctccagggaactcagcaaaccccttaccctcccagatggacactcgctgcctgca
ggaatgactgtggtccttagtatttggggtctccaccacaatcctgctgtctggaaagac
ccaaaggtctttgaccctttgagattcactaaggagaattctgaacagagacacccctgc
gccttcctaccattctccagtggtccaaggaactgcatcgggcagcagtttgccatgctg
gagttaaaggtggccattgccttgactctgctccgcttccgagtagctgcagacctcacc
aggcctcctgccttctccagccacactgtgctcagacccaagcatgggatctatttgcac
ctgaagaaactccctgaatgttag

DBGET integrated database retrieval system