KEGG   Rattus norvegicus (rat): 24680Help
Entry
24680             CDS       T01003                                 

Gene name
Prkca, Pkca
Definition
(RefSeq) protein kinase C, alpha (EC:2.7.11.13)
  KO
K02677  
classical protein kinase C alpha type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
HIF-1 signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Tight junction
Gap junction
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Aldosterone synthesis and secretion
AGE-RAGE signaling pathway in diabetic complications
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Amphetamine addiction
Morphine addiction
African trypanosomiasis
Amoebiasis
Hepatitis B
Influenza A
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Non-small cell lung cancer
Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24680 (Prkca)
   04015 Rap1 signaling pathway
    24680 (Prkca)
   04010 MAPK signaling pathway
    24680 (Prkca)
   04012 ErbB signaling pathway
    24680 (Prkca)
   04310 Wnt signaling pathway
    24680 (Prkca)
   04370 VEGF signaling pathway
    24680 (Prkca)
   04066 HIF-1 signaling pathway
    24680 (Prkca)
   04020 Calcium signaling pathway
    24680 (Prkca)
   04070 Phosphatidylinositol signaling system
    24680 (Prkca)
   04072 Phospholipase D signaling pathway
    24680 (Prkca)
   04071 Sphingolipid signaling pathway
    24680 (Prkca)
   04151 PI3K-Akt signaling pathway
    24680 (Prkca)
   04150 mTOR signaling pathway
    24680 (Prkca)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    24680 (Prkca)
   04530 Tight junction
    24680 (Prkca)
   04540 Gap junction
    24680 (Prkca)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    24680 (Prkca)
   04664 Fc epsilon RI signaling pathway
    24680 (Prkca)
   04666 Fc gamma R-mediated phagocytosis
    24680 (Prkca)
   04670 Leukocyte transendothelial migration
    24680 (Prkca)
  Endocrine system
   04911 Insulin secretion
    24680 (Prkca)
   04912 GnRH signaling pathway
    24680 (Prkca)
   04921 Oxytocin signaling pathway
    24680 (Prkca)
   04918 Thyroid hormone synthesis
    24680 (Prkca)
   04919 Thyroid hormone signaling pathway
    24680 (Prkca)
   04916 Melanogenesis
    24680 (Prkca)
   04925 Aldosterone synthesis and secretion
    24680 (Prkca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24680 (Prkca)
   04270 Vascular smooth muscle contraction
    24680 (Prkca)
  Digestive system
   04970 Salivary secretion
    24680 (Prkca)
   04971 Gastric acid secretion
    24680 (Prkca)
   04972 Pancreatic secretion
    24680 (Prkca)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24680 (Prkca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24680 (Prkca)
  Nervous system
   04724 Glutamatergic synapse
    24680 (Prkca)
   04727 GABAergic synapse
    24680 (Prkca)
   04725 Cholinergic synapse
    24680 (Prkca)
   04728 Dopaminergic synapse
    24680 (Prkca)
   04726 Serotonergic synapse
    24680 (Prkca)
   04720 Long-term potentiation
    24680 (Prkca)
   04730 Long-term depression
    24680 (Prkca)
   04723 Retrograde endocannabinoid signaling
    24680 (Prkca)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24680 (Prkca)
  Development
   04360 Axon guidance
    24680 (Prkca)
  Environmental adaptation
   04713 Circadian entrainment
    24680 (Prkca)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    24680 (Prkca)
   05231 Choline metabolism in cancer
    24680 (Prkca)
   05206 MicroRNAs in cancer
    24680 (Prkca)
   05205 Proteoglycans in cancer
    24680 (Prkca)
   05214 Glioma
    24680 (Prkca)
   05223 Non-small cell lung cancer
    24680 (Prkca)
  Substance dependence
   05031 Amphetamine addiction
    24680 (Prkca)
   05032 Morphine addiction
    24680 (Prkca)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    24680 (Prkca)
  Infectious diseases
   05164 Influenza A
    24680 (Prkca)
   05161 Hepatitis B
    24680 (Prkca)
   05146 Amoebiasis
    24680 (Prkca)
   05143 African trypanosomiasis
    24680 (Prkca)
  Antineoplastic resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    24680 (Prkca)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     24680 (Prkca)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: AGC group
  PKC family [OT]
   24680 (Prkca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Structure
PDB: 

Jmol
Position
10q32.1
AA seq 636 aa AA seqDB search
MADVYPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQLMTKH
PAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPV
LTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtttacccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcatgaggtgaaagaccacaaattcatc
gcccgcttcttcaagcaacccaccttctgcagccactgcaccgacttcatctgggggttt
ggaaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgag
tttgttactttctcttgtccgggtgcggataagggacctgacactgatgaccccagaagc
aagcacaagttcaaaatccacacctatggaagccctaccttctgtgatcactgtgggtcc
ctgctctacggacttatccaccaagggatgaaatgcgacacctgcgacatgaatgttcac
aagcagtgcgtgatcaatgtccccagcctctgcggaatggatcacacagagaagaggggg
cggatttacctgaaggcagaggtcacagatgaaaagctgcacgtcaccgtacgagatgca
aaaaatctaatccctatggatccaaatgggctttcggatccttacgtgaagctgaaactt
attcctgaccccaagaatgagagcaaacagaaaaccaaaaccatccgatccacactgaac
cctcagtggaatgagtccttcacgttcaaattaaaaccttcagacaaagaccggcgactg
tccgtagaaatctgggactgggatcggacgacacggaatgacttcatgggctccctttcc
ttcggcgtctcagagctgatgaagatgccagccagtggatggtacaagttgctcaaccaa
gaggagggtgaatactacaatgtgcccattccagaaggagatgaagaaggcaacgtggaa
ctcaggcagaagttcgagaaagccaagctgggccccgctggaaacaaagtcatcagccct
tcagaagacaggaagcagccatctaacaacctggacagggtgaaactcacagacttcaac
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgctgacaggaaggga
acagaggaactgtacgccatcaaaatcctgaagaaggacgtggtgatccaggatgacgac
gtggagtgcaccatggtggagaagcgggttctggccctgctcgacaagcccccgttcctg
acacagctgcactcctgcttccagacagtggaccggctgtacttcgtcatggaatacgtc
aacggtggggacctcatgtaccacattcagcaagtcggaaaatttaaggagccacaagca
gtattctatgcagccgagatctccatcggactgttctttcttcacaaaagaggaatcatt
tacagggatctgaagctggacaacgtcatgctggactcagaagggcatatcaaaatcgcc
gacttcgggatgtgcaaggaacacatgatggacggggtcacgaccaggaccttctgtggg
actccggattacattgccccagagataatcgcttaccagccatatggaaagtctgtggac
tggtgggcgtacggcgtgctcctgtatgagatgctagctgggcagcttatgaccaaacac
cctgccaagcggctgggctgcgggcccgagggggaaagggatgtcagagagcatgccttc
tttaggaggatcgactgggagaagttggagaacagggagatccaaccgccattcaagccc
aaagtgtgcggcaaaggagcagaaaactttgacaagttcttcacacgagggcagcctgtc
ttaacaccaccagatcagctggtcatcgctaacatagaccagtctgattttgaagggttc
tcgtatgtcaacccccagtttgtgcacccaatcttgcaaagtgcagtatga

DBGET integrated database retrieval system