KEGG   Rattus norvegicus (rat): 24684Help
Entry
24684             CDS       T01003                                 

Gene name
Prlr, RATPRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    24684 (Prlr)
   04151 PI3K-Akt signaling pathway
    24684 (Prlr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24684 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    24684 (Prlr)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    24684 (Prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q16
AA seq 610 aa AA seqDB search
MPSALAFVLLVLNISLLKGQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYS
KEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKDTTVWIIVAILS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTS
DCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCE
EPQAYPPTLHIPEITEKPENPEANIPPTVDPQSTNPNFHVDAPKSSTWPLLPGQHMPRSP
YHSVADVCKLAGSPVNTLDSFLDKAEENVLKLSKALETGEEEVAKQKGAKSFPSDKQNTP
WPLLQEKSPTVYVKPPDYVEIHKVNKDGVLSLFPKQRENNQTEKPGVPETSKEYAKVSGI
MDNNILVLVPDSRAQNTALLEESAKKAPPSFEADQSEKDLASFTATSSNRRLQLGRLDYL
DPTCFMHSFH
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgcacttgctttcgtcctacttgttctcaacatcagcctcctgaagggacag
tcaccaccagggaaacctgagatccacaaatgtcgctctcctgacaaggaaacattcacc
tgctggtggaatcctgggacagatggaggacttcctaccaattattcactgacttacagc
aaagaaggagagaaaaccacctacgaatgtccagactacaaaaccagtggccccaactcc
tgcttctttagcaagcagtacacttccatctggaaaatatatatcatcacagtaaatgcc
acgaaccaaatgggaagcagttcctcggatccactttatgtggatgtgacttacatcgtt
gagccagagcctcctcggaacctgacattagaagtaaaacagctaaaagacaaaaaaaca
tatctgtgggtaaaatggtccccacccaccataactgatgtgaaaactggttggtttaca
atggaatatgaaattcgattaaagcctgaagaagcagaagagtgggagatccattttaca
ggtcatcaaacacagtttaaagtttttgacctatatccagggcaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggagccaggagagttccgttgaa
atgccaaatgacttcaccttgaaggacacaaccgtgtggatcattgtggccattctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggctatagcatgatgacc
tgcatctttccaccagttcctgggccaaaaataaaaggatttgatacccatctgctggag
aagggcaagtctgaagagctgctgagtgccttggggtgccaagactttccccctacttct
gactgtgaggacttgctggtggagttcttagaagttgatgacaatgaggacgagcggcta
atgccatcccattccaaagagtatccaggtcaaggtgttaagcccacacacctagatccc
gacagtgactctggtcacggaagctatgacagccattctcttttatctgaaaagtgtgag
gaaccccaggcctacccccctactttgcacatccctgagatcactgagaagccagagaat
cctgaagcaaatattcctcccaccgtggacccccaaagcaccaaccccaattttcatgta
gatgcacccaaatcttcaacatggccattactgcctggccaacacatgcccagatctcct
taccacagtgttgctgatgtgtgcaagctagccggaagtcctgtgaatacactggactct
ttcttggacaaagcagaggaaaatgttctaaagttgtctaaagcccttgagactggagag
gaagaagtggctaagcaaaaaggggcaaaaagcttcccttctgacaaacaaaacacacct
tggccgctgctccaggagaaaagccccactgtctatgttaaacccccagattatgtggag
attcacaaagtcaacaaagatggagtgctatcattattccccaagcagagagaaaacaac
cagacagagaagcctggggttcctgaaaccagtaaggagtatgccaaggtgtctggcatt
atggataacaatatcctcgtattagtgccagactcacgagcccagaacacagcgttgctc
gaggaatcagccaagaaggctccaccatcgtttgaagctgaccaatctgagaaagatctg
gccagcttcactgcaacctcaagcaaccgcagactccaactgggtaggctggattacctg
gatcctacgtgcttcatgcactcctttcactga

DBGET integrated database retrieval system