KEGG   Rattus norvegicus (rat): 24684Help
Entry
24684             CDS       T01003                                 

Gene name
Prlr, RATPRLR
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Class
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:rno04630]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:rno04080]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:rno04060]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:rno04917]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q16
AA seq 610 aa AA seqDB search
MPSALAFVLLVLNISLLKGQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYS
KEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEMPNDFTLKDTTVWIIVAILS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLEKGKSEELLSALGCQDFPPTS
DCEDLLVEFLEVDDNEDERLMPSHSKEYPGQGVKPTHLDPDSDSGHGSYDSHSLLSEKCE
EPQAYPPTLHIPEITEKPENPEANIPPTVDPQSTNPNFHVDAPKSSTWPLLPGQHMPRSP
YHSVADVCKLAGSPVNTLDSFLDKAEENVLKLSKALETGEEEVAKQKGAKSFPSDKQNTP
WPLLQEKSPTVYVKPPDYVEIHKVNKDGVLSLFPKQRENNQTEKPGVPETSKEYAKVSGI
MDNNILVLVPDSRAQNTALLEESAKKAPPSFEADQSEKDLASFTATSSNRRLQLGRLDYL
DPTCFMHSFH
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgcacttgctttcgtcctacttgttctcaacatcagcctcctgaagggacag
tcaccaccagggaaacctgagatccacaaatgtcgctctcctgacaaggaaacattcacc
tgctggtggaatcctgggacagatggaggacttcctaccaattattcactgacttacagc
aaagaaggagagaaaaccacctacgaatgtccagactacaaaaccagtggccccaactcc
tgcttctttagcaagcagtacacttccatctggaaaatatatatcatcacagtaaatgcc
acgaaccaaatgggaagcagttcctcggatccactttatgtggatgtgacttacatcgtt
gagccagagcctcctcggaacctgacattagaagtaaaacagctaaaagacaaaaaaaca
tatctgtgggtaaaatggtccccacccaccataactgatgtgaaaactggttggtttaca
atggaatatgaaattcgattaaagcctgaagaagcagaagagtgggagatccattttaca
ggtcatcaaacacagtttaaagtttttgacctatatccagggcaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggagccaggagagttccgttgaa
atgccaaatgacttcaccttgaaggacacaaccgtgtggatcattgtggccattctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggctatagcatgatgacc
tgcatctttccaccagttcctgggccaaaaataaaaggatttgatacccatctgctggag
aagggcaagtctgaagagctgctgagtgccttggggtgccaagactttccccctacttct
gactgtgaggacttgctggtggagttcttagaagttgatgacaatgaggacgagcggcta
atgccatcccattccaaagagtatccaggtcaaggtgttaagcccacacacctagatccc
gacagtgactctggtcacggaagctatgacagccattctcttttatctgaaaagtgtgag
gaaccccaggcctacccccctactttgcacatccctgagatcactgagaagccagagaat
cctgaagcaaatattcctcccaccgtggacccccaaagcaccaaccccaattttcatgta
gatgcacccaaatcttcaacatggccattactgcctggccaacacatgcccagatctcct
taccacagtgttgctgatgtgtgcaagctagccggaagtcctgtgaatacactggactct
ttcttggacaaagcagaggaaaatgttctaaagttgtctaaagcccttgagactggagag
gaagaagtggctaagcaaaaaggggcaaaaagcttcccttctgacaaacaaaacacacct
tggccgctgctccaggagaaaagccccactgtctatgttaaacccccagattatgtggag
attcacaaagtcaacaaagatggagtgctatcattattccccaagcagagagaaaacaac
cagacagagaagcctggggttcctgaaaccagtaaggagtatgccaaggtgtctggcatt
atggataacaatatcctcgtattagtgccagactcacgagcccagaacacagcgttgctc
gaggaatcagccaagaaggctccaccatcgtttgaagctgaccaatctgagaaagatctg
gccagcttcactgcaacctcaagcaaccgcagactccaactgggtaggctggattacctg
gatcctacgtgcttcatgcactcctttcactga

DBGET integrated database retrieval system