KEGG   Rattus norvegicus (rat): 24706Help
Entry
24706             CDS       T01003                                 

Gene name
Rarb
Definition
retinoic acid receptor, beta
Orthology
K08528  
retinoic acid receptor beta
Organism
rno  Rattus norvegicus (rat)
Pathway
Pathways in cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    24706 (Rarb)
   05222 Small cell lung cancer
    24706 (Rarb)
   05223 Non-small cell lung cancer
    24706 (Rarb)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    24706 (Rarb)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   24706 (Rarb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
15
AA seq 448 aa AA seqDB search
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACLSGFTQAEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPNS
SGNTAEHSPSVSPSSVETSGVSQSPLLQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcccgggcagatcctggatttctacacc
gcgagcccgtcctcctgcatgctgcaggagaaggctctcaaagcctgcctcagtggattc
acccaggccgaatggcagcaccggcatactgctcaatccatcgagacacagagtaccagc
tctgaggagctcgtcccgagccccccatctccacttccgccgcctcgggtgtacaagccc
tgcttcgtctgccaggacaagtcatcgggctaccactatggcgtcagtgcctgcgagggc
tgcaagggctttttccgacgaagcattcagaagaacatgatctacacttgccaccgggat
aagaactgcgttattaacaaggtcactaggaatcgatgccagtactgccgcctgcagaag
tgctttgaagtgggcatgtccaaagagtctgtcaggaatgacaggaacaagaaaaagaag
gagccttcaaagcaggagtgcacagagagctatgagatgacagcggagctggatgacctc
accgagaagatccggaaagcccaccaggaaacctttccctcactctgccagctgggtaaa
tacaccacgaattccagtgctgaccaccgggtccgattggacctgggcctctgggacaaa
ttcagtgagctggccaccaagtgcattattaagatcgtggagttcgccaagcgtctgccg
ggcttcacgggcctgaccatcgcagaccagatcaccctgctcaaggccgcctgcttggac
atcctgattctcagaatttgtaccaggtataccccagagcaagacaccatgactttctct
gatggccttaccctaaatcgaactcagatgcacaatgctggcttcggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggt
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccaacaaaa
gtagacaagctccaagagccgctgctggaagcactaaagatttacattagaaaacgacgg
cccagcaagccccacatgtttccaaagatcttaatgaaaatcacggatctccgcagcatc
agcgccaaaggtgcagaacgtgtaattaccttgaaaatggaaattcctggatcgatgcca
cctctcattcaggaaatgctggagaattctgaaggacatgaacccttgacccccaattcc
agtgggaatacagcagagcacagtcccagcgtgtcccccagctcagtggagaccagtgga
gtgagccagtccccgctgctgcagtga

DBGET integrated database retrieval system