KEGG   Rattus norvegicus (rat): 24829Help
Entry
24829             CDS       T01003                                 

Gene name
Hist1h2ba, Th2b
Definition
histone cluster 1, H2ba
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    24829 (Hist1h2ba)
  Immune diseases
   05322 Systemic lupus erythematosus
    24829 (Hist1h2ba)
  Substance dependence
   05034 Alcoholism
    24829 (Hist1h2ba)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24829 (Hist1h2ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17p11
AA seq 127 aa AA seqDB search
MPEVSAKGTTISKKGFKKAVTKTQKKEGRKRKRCREESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtgtcggcaaaggggactactatttccaagaaagggttcaagaaagcagtc
accaagacccagaagaaggagggccggaaacgtaagagatgccgcgaagagagttactcc
atctacatttataaggtgctgaagcaagtgcacccggacaccggcatctcttccaaggcc
atgagcatcatgaactccttcgtgacagacatcttcgagcgcatcgcgggcgaggcatcg
cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggctgtc
cgcctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtc
accaagtacaccagctccaagtga

DBGET integrated database retrieval system