KEGG   Rattus norvegicus (rat): 24829Help
Entry
24829             CDS       T01003                                 

Gene name
Hist1h2ba, Th2b, histone
Definition
(RefSeq) histone cluster 1 H2B family member a
  KO
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    24829 (Hist1h2ba)
  Immune diseases
   05322 Systemic lupus erythematosus
    24829 (Hist1h2ba)
  Substance dependence
   05034 Alcoholism
    24829 (Hist1h2ba)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    24829 (Hist1h2ba)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24829 (Hist1h2ba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
17p11
AA seq 127 aa AA seqDB search
MPEVSAKGTTISKKGFKKAVTKTQKKEGRKRKRCREESYSIYIYKVLKQVHPDTGISSKA
MSIMNSFVTDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV
TKYTSSK
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgccggaggtgtcggcaaaggggactactatttccaagaaagggttcaagaaagcagtc
accaagacccagaagaaggagggccggaaacgtaagagatgccgcgaagagagttactcc
atctacatttataaggtgctgaagcaagtgcacccggacaccggcatctcttccaaggcc
atgagcatcatgaactccttcgtgacagacatcttcgagcgcatcgcgggcgaggcatcg
cgcctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggctgtc
cgcctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtc
accaagtacaccagctccaagtga

DBGET integrated database retrieval system