KEGG   Rattus norvegicus (rat): 24851Help
Entry
24851             CDS       T01003                                 

Gene name
Tpm1, Alpha-tm, Tma2, Tmsa
Definition
tropomyosin 1, alpha
Orthology
K10373  
tropomyosin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    24851 (Tpm1)
   04261 Adrenergic signaling in cardiomyocytes
    24851 (Tpm1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    24851 (Tpm1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    24851 (Tpm1)
   05414 Dilated cardiomyopathy (DCM)
    24851 (Tpm1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   24851 (Tpm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24
AA seq 287 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDKFLCFSPPKTPSSSRMSHLSELCICLLSS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaagagaacgccttggat
cgagcagagcaggcggaggctgacaagaaggctgcggaagaccggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaaactggagctggcggagaaaaaggccacagat
gctgaagctgacgtagcatctctgaacagacgcatccagctggttgaggaggagttggat
cgcgctcaggagcgtctggccacagctctacagaagctggaggaggctgagaaggctgca
gatgagagtgagagaggcatgaaagtcattgaaagccgagcccaaaaagatgaagaaaag
atggagattcaggagatccagctgaaagaggccaagcacattgctgaagatgctgaccga
aagtatgaagaggtggcccgtaagctggtcatcatcgagagcgatctggagcgtgcggag
gagagggctgagctctcggaaggcaaatgtgccgagcttgaagaagagttgaaaacggtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactctcagaaagaagacaag
tatgaagaggagatcaaggttctctctgacaagctgaaggaggctgagacccgggctgag
tttgcagagagatcagtaaccaaattggagaaaagcattgatgacttagaagataagttt
ctttgcttctctcctcccaagactccttcatcaagccggatgtcccacctctctgagctc
tgcatctgtctgctctccagctga

DBGET integrated database retrieval system