KEGG   Rattus norvegicus (rat): 24851Help
Entry
24851             CDS       T01003                                 

Gene name
Tpm1, Alpha-tm, Tma2, Tmsa
Definition
tropomyosin 1, alpha
Orthology
K10373  
tropomyosin 1
Organism
rno  Rattus norvegicus (rat)
Pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
MicroRNAs in cancer
Hypertrophic cardiomyopathy (HCM)
Dilated cardiomyopathy
Class
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:rno04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:rno04261]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:rno05206]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:rno05410]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:rno05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q24
AA seq 287 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKY
SEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDKFLCFSPPKTPSSSRMSHLSELCICLLSS
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaagaagaagatgcagatgctgaagctcgacaaagagaacgccttggat
cgagcagagcaggcggaggctgacaagaaggctgcggaagaccggagcaagcagctggaa
gatgagctggtgtcactgcaaaagaaactcaagggcactgaagatgaactggacaaatac
tccgaggctctcaaagatgcccaggagaaactggagctggcggagaaaaaggccacagat
gctgaagctgacgtagcatctctgaacagacgcatccagctggttgaggaggagttggat
cgcgctcaggagcgtctggccacagctctacagaagctggaggaggctgagaaggctgca
gatgagagtgagagaggcatgaaagtcattgaaagccgagcccaaaaagatgaagaaaag
atggagattcaggagatccagctgaaagaggccaagcacattgctgaagatgctgaccga
aagtatgaagaggtggcccgtaagctggtcatcatcgagagcgatctggagcgtgcggag
gagagggctgagctctcggaaggcaaatgtgccgagcttgaagaagagttgaaaacggtg
acgaacaacttgaagtcactggaggctcaggctgagaagtactctcagaaagaagacaag
tatgaagaggagatcaaggttctctctgacaagctgaaggaggctgagacccgggctgag
tttgcagagagatcagtaaccaaattggagaaaagcattgatgacttagaagataagttt
ctttgcttctctcctcccaagactccttcatcaagccggatgtcccacctctctgagctc
tgcatctgtctgctctccagctga

DBGET integrated database retrieval system