KEGG   Rattus norvegicus (rat): 24862Help
Entry
24862             CDS       T01003                                 

Gene name
Ugt2b, Ugt2b2
Definition
UDP glycosyltransferase 2 family, polypeptide B (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    24862 (Ugt2b)
   00053 Ascorbate and aldarate metabolism
    24862 (Ugt2b)
   00500 Starch and sucrose metabolism
    24862 (Ugt2b)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24862 (Ugt2b)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24862 (Ugt2b)
   00860 Porphyrin and chlorophyll metabolism
    24862 (Ugt2b)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    24862 (Ugt2b)
   00982 Drug metabolism - cytochrome P450
    24862 (Ugt2b)
   00983 Drug metabolism - other enzymes
    24862 (Ugt2b)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    24862 (Ugt2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     24862 (Ugt2b)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   24862 (Ugt2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p22-p21.2
AA seq 530 aa AA seqDB search
MPRKWISALFLLQISYCFKSGHCGKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSA
YFFLDPKKSSDLKFEIFPTSISKDELQNHFIKLLDVWTYELPRDTCLSYSPILQNLVYEF
SYFYLSICKDAVSNKQLMTKLQESKFDVLFADPVASCGDLIAELLHIPFLYSLSFSPGHK
LEKSIGKFILPPSYVPVILSGLAGKMTFIDRVKNMICMLYFDFWFERLRHKEWDTFYSEI
LGRPTTVDETMSKVEIWLIRSYWDLKFPHPTLPNVDYIGGLHCKPAKPLPKDMEEFVQSS
GEHGVVVFSLGSMVSNMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQ
NDILGHPKTKAFVTHGGANGLYEAIYHGIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRT
MSKLDFLSALEEVIDNPFYKKNVMLLSTIHHDQPMKPLDRAVFWIEFIMRHKGAKHLRPL
GHNLPWYQYHSLDVIGFLLTCFAVIAALTVKCLLFMYRFFVKKEKKMKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcccagaaagtggatttctgctctgttcctgctacagataagttactgtttcaaatct
gggcactgtgggaaggtgttggtgtggccgatggactttagtcactggatgaatataaaa
ataatccttgatgaacttgtacagaggggccatgaggtcactgttctgaaaccttcggct
tacttttttcttgatccgaaaaaatcgtctgaccttaagtttgaaatttttcctacatct
atcagtaaagatgagctgcaaaatcatttcataaaacttttggatgtgtggacttatgag
ttgccaagagatacatgtttgtcatattctcctatccttcaaaatctagtttatgaattt
tcttatttttatctaagtatttgtaaagacgctgtttcaaacaagcagctcatgacaaaa
ctacaggaatccaagtttgatgttcttttcgcagatcctgtggcttcctgtggggatctg
atagctgaactgctccacattccttttctgtacagtcttagcttctctccaggccacaaa
cttgaaaagtccattggaaaatttatactccctccatcttatgtgcctgtaattttgtcg
ggactggctggcaaaatgacattcatagacagggtaaaaaatatgatatgtatgctttat
ttcgacttttggttcgagagacttagacacaaggaatgggacacattttacagtgagatt
ttgggaaggcccaccaccgtagatgagacaatgagcaaagtagaaatatggcttattaga
tcctattgggatttgaaatttccccacccaacattaccaaatgttgactatattggagga
ctccattgcaaacctgctaaacccttgcctaaggatatggaagaatttgtccagagctct
ggagagcacggtgtggtggtgttttctctggggtcaatggtcagcaacatgacagaagaa
aaggccaacgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaacattaggacccaataccagagtctacaagtggctcccgcag
aatgacatcctgggtcacccaaaaaccaaagcctttgtaactcatggtggagccaatggc
ctctatgaggcaatctatcatggaatccctatgattggcattcctctgtttggagatcaa
cctgataatattgcccacatggtggccaaaggagcagctgtttcattgaatatcaggaca
atgtcaaagttagattttctcagtgcactggaggaagtcatagacaatccgttctataaa
aaaaatgttatgttgttgtcaaccattcaccatgaccagcctatgaagcccctggacaga
gctgtcttctggattgagtttatcatgcgccacaaaggggccaagcacctgagaccactt
ggacataaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgttttgcagtcattgcagctcttactgtaaaatgtctcttgttcatgtaccgattcttt
gtaaagaaggaaaagaaaatgaagaatgagtag

DBGET integrated database retrieval system