KEGG   Rattus norvegicus (rat): 24873Help
Entry
24873             CDS       T01003                                 

Gene name
Vdr, Nr1i1
Definition
(RefSeq) vitamin D (1,25- dihydroxyvitamin D3) receptor
  KO
K08539  
vitamin D3 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocrine and other factor-regulated calcium reabsorption
Mineral absorption
Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    24873 (Vdr)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24873 (Vdr)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    24873 (Vdr)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24873 (Vdr)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    24873 (Vdr)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   24873 (Vdr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 423 aa AA seqDB search
MEATAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMIMKRKEEEALKDSL
RPKLSEEQQHIIAILLDAHHKTYDPTYADFRDFRPPVRMDGSTGSYSPRPTLSFSGNSSS
SSSDLYTTSLDMMEPSGFSNLDLNGEDSDDPSVTLDLSPLSMLPHLADLVSYSIQKVIGF
AKMIPGFRDLTSDDQIVLLKSSAIEVIMLRSNQSFTMDDMSWDCGSQDYKYDVTDVSKAG
HTLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAKLVEAIQDRLSNTLQ
TYIRCRHPPPGSHQLYAKMIQKLADLRSLNEEHSKQYRSLSFQPENSMKLTPLVLEVFGN
EIS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaacagcggccagcacctccctgcccgaccctggtgactttgaccggaacgtg
ccccggatctgtggagtgtgtggagaccgagccacaggcttccacttcaatgctatgacc
tgtgaaggctgcaaaggtttcttcaggcggagcatgaagcggaaggccctgttcacctgt
cccttcaatggagattgccgcatcaccaaggacaaccggcgacactgccaggcctgccgg
ctcaaacgctgtgtggacatcggcatgatgaaggagttcatcctgacagatgaggaggta
cagcgtaagagggagatgataatgaagagaaaagaggaagaggccttgaaggacagtctg
aggcccaagctatctgaagaacaacagcacatcatagccatcctgctggacgcccaccac
aagacctatgaccccacctacgctgacttcagggacttccggcctccagttcgtatggac
ggaagtacagggagctattctccaaggcccacactcagcttctccgggaactcctcctcc
tccagctctgacctgtacaccacctcactagacatgatggaaccatccggcttttccaac
ctggatctgaacggagaggattctgatgacccgtctgtgactctggacctgtctcctctc
tccatgctgccccacctggctgaccttgtcagttacagcatccaaaaggtcatcggcttt
gccaagatgatcccaggattcagggatctcacctccgatgaccagattgtcctgcttaag
tcaagcgccattgaggtgatcatgttacgctccaaccagtctttcaccatggatgatatg
tcctgggactgtggcagccaggactacaagtacgacgtcaccgatgtctccaaagctggg
cacaccctggagctgatcgagcccctcataaagttccaggtggggctgaagaagctgaac
ttacatgaggaagagcatgtccttctcatggccatctgcattgtctccccggaccgacct
ggggtccaggacgccaagctggtggaagccattcaggaccgcctatccaacacgctgcag
acctacatccgctgccgccacccgcccccaggcagccaccagctctatgccaagatgatc
cagaaactggccgacctgcggagcctcaacgaggaacactccaaacaataccgctccctc
tccttccagcccgagaatagcatgaagctcacaccccttgtgctggaggtgttcggcaat
gagatctcctga

DBGET integrated database retrieval system