KEGG   Rattus norvegicus (rat): 24894Help
Entry
24894             CDS       T01003                                 

Gene name
Cyp2a1, RATCYP2A1, Shdl
Definition
cytochrome P450, family 2, subfamily a, polypeptide 1 (EC:1.14.14.1)
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24894 (Cyp2a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24894 (Cyp2a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   24894 (Cyp2a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 492 aa AA seqDB search
MLDTGLLLVVILASLSVMLLVSLWQQKIRGRLPPGPTPLPFIGNYLQLNTKDVYSSITQL
SERYGPVFTIHLGPRRVVVLYGYDAVKEALVDQAEEFSGRGEQATYNTLFKGYGVAFSSG
ERAKQLRRLSIATLRDFGVGKRGVEERILEEAGYLIKMLQGTCGAPIDPTIYLSKTVSNV
ISSIVFGERFDYEDTEFLSLLQMMGQMNRFAASPTGQLYDMFHSVMKYLPGPQQQIIKVT
QKLEDFMIEKVRQNHSTLDPNSPRNFIDSFLIRMQEEKNGNSEFHMKNLVMTTLSLFFAG
SETVSSTLRYGFLLLMKHPDVEAKVHEEIEQVIGRNRQPQYEDHMKMPYTQAVINEIQRF
SNLAPLGIPRRIIKNTTFRGFFLPKATDVFPILGSLMTDPKFFPSPKDFDPQNFLDDKGQ
LKKNAAFLPFSTGKRFCLGDGLAKMELFLLLTTILQNFRFKFPMKLEDINESPKPLGFTR
IIPKYTMSFMPI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctggacacaggactgcttctggtggtcatattggcctccctgagcgtcatgctcttg
gtgtccctctggcagcagaaaatcagggggagattgcctccaggacccactcctttgcct
ttcattggaaattatctgcagctgaatacaaaagacgtatacagttccatcacacagctc
agtgagcgctatggtcctgtgttcaccatccaccttgggcctcgccgggttgtggtgctt
tatggatacgatgcagtcaaagaggctttggtggaccaagctgaggagttcagtggacga
ggcgaacaggctacctacaatacactcttcaaaggctatggcgtggcattcagcagtggg
gagcgggcaaaacaactcaggcgcctctctatagccacattgagagattttggtgtgggc
aagcgtggtgtagaggagcgtatcctggaggaggcaggctatttgatcaagatgttgcag
ggcacttgtggagcccccattgaccccaccatctacctgagcaaaacagtctccaatgtt
attagctccattgtcttcggggaacgcttcgactatgaggacacggagttcctgtcactg
ctgcagatgatgggtcaaatgaacagatttgcagcttcacccacagggcagctctatgac
atgttccattcagtgatgaagtacctgcctggaccacagcaacagatcatcaaggttact
cagaaactggaagacttcatgatagagaaagtgaggcagaaccatagtaccctggacccc
aattccccaaggaacttcattgactcctttctcatccgcatgcaagaggagaaaaatggc
aattcagagttccacatgaagaacctagtgatgacaacactaagcctcttctttgctggg
tctgagacagtcagctccacactacgctacggcttccttctactcatgaagcatccagat
gtggaggccaaggtccatgaggaaattgagcaggtgatcggcaggaaccgacagcctcag
tatgaggaccacatgaagatgccctacacccaggctgtgatcaatgagatccaaagattt
tctaacttggctcccttgggcattcctcgaaggattatcaagaacacaaccttccgtggc
ttcttcctccccaaggccaccgatgtgttccctatattaggttctctgatgacagaccca
aagttcttccctagccccaaagacttcgacccccagaacttcctggatgacaagggacag
ttgaagaaaaatgctgctttcctccctttctccactgggaagcgattctgcttgggagat
ggcctggctaagatggagctcttcctgctgctcaccactattttacagaacttccgtttc
aagttcccaatgaaactagaagacatcaacgagtcccccaaacccttggggtttaccagg
atcataccaaagtacaccatgagcttcatgcccatctga

DBGET integrated database retrieval system