KEGG   Rattus norvegicus (rat): 24913Help
Entry
24913             CDS       T01003                                 

Gene name
Pla2g16, HRSL3, Hrasls3, Hrev107
Definition
(RefSeq) phospholipase A2, group XVI
  KO
K16817  HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00592  alpha-Linolenic acid metabolism
rno01100  Metabolic pathways
rno04014  Ras signaling pathway
rno04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    24913 (Pla2g16)
   00565 Ether lipid metabolism
    24913 (Pla2g16)
   00590 Arachidonic acid metabolism
    24913 (Pla2g16)
   00591 Linoleic acid metabolism
    24913 (Pla2g16)
   00592 alpha-Linolenic acid metabolism
    24913 (Pla2g16)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24913 (Pla2g16)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    24913 (Pla2g16)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     24913 (Pla2g16)
    3.1.1.32  phospholipase A1
     24913 (Pla2g16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT Calici_PP_N NLPC_P60 Peptidase_C97
Motif
Other DBs
NCBI-GeneID: 24913
NCBI-ProteinID: NP_058756
RGD: 2829
Ensembl: ENSRNOG00000021206
UniProt: P53817
Position
1q43
AA seq 160 aa AA seqDB search
MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKK
ELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRY
GVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcccataccagaacccaagcctggagatctgattgagattttccgccctatgtacagt
cactgggccatctatgttggtgatggatatgtgatccacctggctcccccaagtgaaatc
ccaggagctggggcagccagcatcatgtctgctttgacggacaaggccatagtgaagaaa
gagctgctgcgtgatgtggctgggaaggacaagtaccaggtcaacaacaagcacgacaag
gagtacactccgctgcctctgaacaagatcatccagcgagctgaggagctggtggggcag
gaggtgctgtacaggctgaccagtgagaactgtgagcacttcgtgaacgaactgcgttat
ggagtccctcggagtgaccaggtcagagatgccgtcaaggtggcgaccgtcactggagtg
ggcttggcggccttgggcctcattggagtcatgctctcaagaaacaagaaacagaagcag
tga

DBGET integrated database retrieval system