KEGG   Rattus norvegicus (rat): 24913Help
Entry
24913             CDS       T01003                                 

Gene name
Pla2g16, HRSL3, Hrasls3, Hrev107
Definition
phospholipase A2, group XVI (EC:3.1.1.4 3.1.1.32)
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rno00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:rno00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:rno00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:rno00592]
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:rno04014]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 160 aa AA seqDB search
MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKK
ELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRY
GVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcccataccagaacccaagcctggagatctgattgagattttccgccctatgtacagt
cactgggccatctatgttggtgatggatatgtgatccacctggctcccccaagtgaaatc
ccaggagctggggcagccagcatcatgtctgctttgacggacaaggccatagtgaagaaa
gagctgctgcgtgatgtggctgggaaggacaagtaccaggtcaacaacaagcacgacaag
gagtacactccgctgcctctgaacaagatcatccagcgagctgaggagctggtggggcag
gaggtgctgtacaggctgaccagtgagaactgtgagcacttcgtgaacgaactgcgttat
ggagtccctcggagtgaccaggtcagagatgccgtcaaggtggcgaccgtcactggagtg
ggcttggcggccttgggcctcattggagtcatgctctcaagaaacaagaaacagaagcag
tga

DBGET integrated database retrieval system