KEGG   Rattus norvegicus (rat): 24913Help
Entry
24913             CDS       T01003                                 

Gene name
Pla2g16, HRSL3, Hrasls3, Hrev107
Definition
phospholipase A2, group XVI (EC:3.1.1.4 3.1.1.32)
Orthology
K16817  
HRAS-like suppressor 3 [EC:3.1.1.32 3.1.1.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    24913 (Pla2g16)
   00565 Ether lipid metabolism
    24913 (Pla2g16)
   00590 Arachidonic acid metabolism
    24913 (Pla2g16)
   00591 Linoleic acid metabolism
    24913 (Pla2g16)
   00592 alpha-Linolenic acid metabolism
    24913 (Pla2g16)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    24913 (Pla2g16)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     24913 (Pla2g16)
    3.1.1.32  phospholipase A1
     24913 (Pla2g16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q43
AA seq 160 aa AA seqDB search
MPIPEPKPGDLIEIFRPMYSHWAIYVGDGYVIHLAPPSEIPGAGAASIMSALTDKAIVKK
ELLRDVAGKDKYQVNNKHDKEYTPLPLNKIIQRAEELVGQEVLYRLTSENCEHFVNELRY
GVPRSDQVRDAVKVATVTGVGLAALGLIGVMLSRNKKQKQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcccataccagaacccaagcctggagatctgattgagattttccgccctatgtacagt
cactgggccatctatgttggtgatggatatgtgatccacctggctcccccaagtgaaatc
ccaggagctggggcagccagcatcatgtctgctttgacggacaaggccatagtgaagaaa
gagctgctgcgtgatgtggctgggaaggacaagtaccaggtcaacaacaagcacgacaag
gagtacactccgctgcctctgaacaagatcatccagcgagctgaggagctggtggggcag
gaggtgctgtacaggctgaccagtgagaactgtgagcacttcgtgaacgaactgcgttat
ggagtccctcggagtgaccaggtcagagatgccgtcaaggtggcgaccgtcactggagtg
ggcttggcggccttgggcctcattggagtcatgctctcaagaaacaagaaacagaagcag
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system