KEGG   Rattus norvegicus (rat): 24950Help
Entry
24950             CDS       T01003                                 

Gene name
Srd5a1, S5AR_1
Definition
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1) (EC:1.3.1.22)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24950 (Srd5a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     24950 (Srd5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17p14
AA seq 255 aa AA seqDB search
MELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQELPSM
AWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLAFLFC
TFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYK
IPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWYHEKF
EDYPKSRKILIPFVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggagttggatgagctgtgcctgctcgacatgctggtctacttggaaggtttcatggcc
ttcgtgtccattgtggggctccggtcggttggctctccgtacggccgctactcgccgcag
tggcccggcatccgagtgcccgcgcgacctgcctggttcatacaggagctgccctcgatg
gcctggccgctgtacgagtacattcgtcctgcagccgcgcgactgggcaacctgcctaac
cgcgtcctgctggctatgtttctgatccactacgtgcaaaggacgctggttttcccggtt
ctgatcaggggagggaagcccaccctcctggtcacctttgtcttggccttcctgttctgc
accttcaacggctatgtacagagcagatacttgagccagtttgcggtttatgctgaagac
tgggtgacccatccctgtttcctgacaggctttgccctgtggttagtgggcatggtgata
aatatccactcagaccacatcctgaggaatctgagaaaaccaggggaaactggatacaag
atacccaggggaggcctgtttgaatacgtatctgcagccaactattttggggagctcgtg
gagtggtgtggctttgcactggccagctggtccctccagggtgtagtgtttgcactgttc
acactcagcacactgctcaccagagcgaagcagcaccatcagtggtaccatgagaagttt
gaagattaccccaagtcaagaaaaatactgattccatttgtgctttag

DBGET integrated database retrieval system