KEGG   Rattus norvegicus (rat): 24959Help
Entry
24959             CDS       T01003                                 

Gene name
Pgam2, D14Mgh1, PGAM-M, Pgmut
Definition
phosphoglycerate mutase 2 (muscle) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:rno01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rno01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rno00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rno00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14q21-q22
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESSWNQENRFCGWFDAELSEKGAEEAKRGATAIKDAKIEFDICYTSVL
KRAIRTLWTILDVTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
TPPPPMDEKHNYYASISKDRRYAGLKPEELPTCESLKDTIARALPFWNEEIAPKIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNQELKPTKPMRFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaccgcctagtaatggtccgccacggtgagagctcatggaaccaagagaac
cgtttctgtggctggtttgatgcagaactgagtgagaagggggcagaggaggccaagcgg
ggggccactgccatcaaagatgccaagatagagtttgacatctgctacacgtcggtgctg
aagcgggctatccgcaccctttggaccatcctggatgttacggaccaaatgtgggtgccc
gtggtgcgcacctggcgcctcaatgagcggcactatggaggtctcacgggcctcaataag
gctgagacggctgcaaagcatggggaggagcaggtgaagatctggaggcgttcctttgac
accccgccaccacctatggacgagaaacacaactactacgcctccatcagcaaggatcgg
cgctatgcaggcttgaagcctgaggagctgcctacctgtgagagcctcaaggacaccatt
gcccgggctctgcccttctggaatgaggagatcgcacctaagattaaggctggcaagaga
gtccttattgcagcccatgggaacagccttcgaggcattgtcaagcatctggaagggatg
tcagaccaggccatcatggaactgaatctgcccaccggaatccccattgtctatgagctg
aaccaggagctgaagcccaccaagcccatgaggttcctgggagacgaagagacagttcgg
aaggccatggaggctgtggctgcccagggaaaggcaaagtga

DBGET integrated database retrieval system