KEGG   Rattus norvegicus (rat): 24968Help
Entry
24968             CDS       T01003                                 

Gene name
Psmb8, Lmp7, Ring10
Definition
(RefSeq) proteasome subunit beta 8 (EC:3.4.25.1)
  KO
K02740  
20S proteasome subunit beta 8 [EC:3.4.25.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Proteasome
Module
Immunoproteasome
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    24968 (Psmb8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     24968 (Psmb8)
Peptidases [BR:rno01002]
 Threonine Peptidases
  Family T1: proteasome family
   24968 (Psmb8)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    24968 (Psmb8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Position
20p12
AA seq 276 aa AA seqDB search
MALLDLCGAPRGQRPEWAAVDAGSGLRSDPGHYSFSVQAPELALPRGMQPTEFLRSFGDD
QERKVQIEMAHGTTTLAFKFQHGVIVAVDSRASAGSYIATIRVNKVIEINPYLLGTMSGC
AADCQYWERLLAKECRLYYLRNGERISVSAASKLLSNMMLQYRGMGLSMGSMICGWDKKG
PGLYYVDDNGTRLSGQMFSTGSGNTYAYGVMDSGYRQDLSPEEAYDLARRAIVYATHRDS
YSGGVVNMYHMKKDGWVKVESTDVSDLLHKYREATL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atggcgttactggatctgtgcggcgctcctcgggggcagcggcccgagtgggctgccgtg
gatgcaggaagcgggcttcgctcggacccgggacactacagtttctccgtgcaagctccg
gagctcgcgcttccccggggaatgcagcccactgaattcctaaggtcctttggtgatgac
caggaaaggaaggttcagattgaaatggcgcacggcacaaccacgctggccttcaagttc
cagcatggagtcatcgtggcggtggactccagggcctccgcaggaagttacattgctacc
ataagggtgaacaaggtgatcgagattaacccttacctgcttggaaccatgtctggttgt
gcagccgactgtcagtactgggagaggctgttggccaaggaatgcaggctatactatctg
cggaatggggaacgcatctccgtgtctgcagcctccaagctactttccaacatgatgctg
cagtaccggggtatgggcctctccatgggcagcatgatctgcggctgggacaagaaggga
ccgggactttattacgtagatgacaatgggactcggctctcgggacagatgttctccaca
ggcagcgggaacacctatgcctacggggtgatggacagtgggtaccggcaggatctcagt
cctgaggaggcctacgaccttgcccgaagagctattgtttatgctacccacagagacagc
tattctggaggagttgtcaacatgtaccacatgaagaaagacggttgggtgaaagtggag
agcactgacgtcagtgacctgctgcacaagtaccgagaggccactctgtga

DBGET integrated database retrieval system