KEGG   Rattus norvegicus (rat): 25011Help
Entry
25011             CDS       T01003                                 

Gene name
Cyp2c12, Cyp2c40, P450pb1, RATP4515B2, RATP4515B8
Definition
cytochrome P450, family 2, subfamily c, polypeptide 12 (EC:1.14.14.1)
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    25011 (Cyp2c12)
   00590 Arachidonic acid metabolism
    25011 (Cyp2c12)
   00591 Linoleic acid metabolism
    25011 (Cyp2c12)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    25011 (Cyp2c12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    25011 (Cyp2c12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    25011 (Cyp2c12)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    25011 (Cyp2c12)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     25011 (Cyp2c12)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   25011 (Cyp2c12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q53
AA seq 490 aa AA seqDB search
MDPFVVLVLSLSFLLLLYLWRPSPGRGKLPPGPTPLPIFGNFLQIDMKDIRQSISNFSKT
YGPVFTLYFGSQPTVVLHGYEAVKEALIDYGEEFSGRGRMPVFEKATKGLGISFSRGNVW
RATRHFTVNTLRSLGMGKRTIEIKVQEEAEWLVMELKKTKGSPCDPKFIIGCAPCNVICS
IIFQNRFDYKDKDFLSLIENVNEYIKIVSTPAFQVFNAFPILLDYCPGNHKTHSKHFAAI
KSYLLKKIKEHEESLDVSNPRDFIDYFLIQRCQENGNQQMNYTQEHLAILVTNLFIGGTE
TSSLTLRFALLLLMKYPHITDKVQEEIGQVIGRHRSPCMLDRIHMPYTNAMIHEVQRYID
LAPNGLLHEVTCDTKFRDYFIPKGTAVLTSLTSVLHARKEFPNPEMFDPGHFLDENGNFK
KSDYFMPFSAGKRKCVGEGLASMELFLFLTTILQNFKLKSLSDPKDIDINSIRSEFSSIP
PTFQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatccatttgtggtcttggtgctcagtctgtcctttctgcttctcctgtatctatgg
agaccaagccctgggagagggaagcttcctcctggccctactcctctcccaatttttgga
aattttcttcagatagatatgaaggacatccgtcaatcaatatccaatttttctaaaacc
tatggccctgtgttcactttgtatttcggctcacagcctactgtggtattgcatggctat
gaggcagtgaaagaagccctcattgattatggggaagagttctctggaaggggaagaatg
ccagtttttgaaaaggctactaaaggactgggcattagttttagccgtggaaatgtatgg
agagccacaagacatttcacagtcaataccctgaggagtttgggcatggggaaacggacc
attgagatcaaagtgcaagaggaagcagagtggctagtgatggaactgaagaaaaccaaa
ggctcaccctgtgatcccaaattcatcataggatgtgctccctgcaatgtcatctgctcc
attatcttccagaatcgtttcgattataaagataaggattttcttagcttgatagaaaac
gtgaatgagtacattaaaattgtgagcactcctgcatttcaggttttcaacgcattccct
attcttctggattattgtccaggaaatcataagacacattcaaaacattttgctgctatt
aagagttaccttttgaagaaaataaaagaacatgaagaatcgttggatgtttcaaatcct
cgggacttcattgattacttcctaattcaaagatgtcaggaaaatggcaatcagcagatg
aactatacacaagaacatctggcaatcctggtgactaatttgtttattggtggaacagag
acatcaagcttaacgctgagatttgcacttttgctcttgatgaagtacccacacatcaca
gataaagtccaggaagagattggccaagtgattgggagacaccgcagcccctgtatgttg
gacaggatccacatgccctacacaaatgccatgattcatgaggttcagagatatattgac
cttgccccaaatggtttgttgcatgaagtgacctgtgacactaaattcagagactacttc
atacccaagggaacagcagtactaacatcacttacatcagtgctgcatgcacgtaaggaa
ttccccaacccagagatgtttgacccaggtcactttctagatgagaatggaaactttaag
aaaagtgactacttcatgcctttctcagcaggaaaacggaaatgtgtgggagagggcctt
gccagtatggagctgtttttgttcctgaccaccattttacagaatttcaaactgaaatct
ctgtctgatccaaaggacatcgatataaactcaatacgttctgagttttcatcaattcct
ccaactttccagctgtgcttcattcctgtctaa

DBGET integrated database retrieval system