KEGG   Rattus norvegicus (rat): 25014Help
Entry
25014             CDS       T01003                                 

Gene name
Acat1, RATACAL
Definition
(RefSeq) acetyl-CoA acetyltransferase 1 (EC:2.3.1.9)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    25014 (Acat1)
   01212 Fatty acid metabolism
    25014 (Acat1)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    25014 (Acat1)
   00630 Glyoxylate and dicarboxylate metabolism
    25014 (Acat1)
   00640 Propanoate metabolism
    25014 (Acat1)
   00650 Butanoate metabolism
    25014 (Acat1)
  Lipid metabolism
   00071 Fatty acid degradation
    25014 (Acat1)
   00072 Synthesis and degradation of ketone bodies
    25014 (Acat1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    25014 (Acat1)
   00310 Lysine degradation
    25014 (Acat1)
   00380 Tryptophan metabolism
    25014 (Acat1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    25014 (Acat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     25014 (Acat1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25014 (Acat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q24.1
AA seq 424 aa AA seqDB search
MAALAVLHGVVRRPLLRGLLQEVRCLGRSYASKPTLNDVVIVSATRTPIGSFLGSLASQP
ATKLGTIAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPIATPCTTVN
KVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDG
LTDVYNKIHMGNCAENTAKKLSISREEQDKYAIGSYTRSKEAWDAGKFANEITPITISVK
GKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAAVVLMTAEAAQR
LKVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLAN
IKMLEIDPQKVNVHGGAVSLGHPIGMSGARIVVHLAHALKQGEFGLASICNGGGGASAVL
IEKL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctggcggttctacacggcgtcgtccgcaggcctctgctccgcgggctgctg
caggaagtaagatgcctgggacgaagttatgcatccaaacccactttgaatgatgtggtt
atagtgagtgctacacgaactcccattggatccttcctgggcagccttgcctctcagcca
gccaccaagcttggtactattgcaattcagggagccattgaaaaggcagggattccaaaa
gaagaagtgaaggaggtctacatgggcaacgtcatccaagggggagaaggacaggccccg
accaggcaagctacactgggtgcaggtctacccattgccactccgtgcaccacagtaaac
aaggtgtgtgcctcaggaatgaaagccatcatgatggcctctcaaagtcttatgtgtgga
caccaggatgtgatggtggcaggcggaatggagagcatgtcaaatgtcccgtacgtaatg
agcagaggagcaacaccatacggtggggtaaaacttgaagacctgattgtgaaagacggg
ctaaccgatgtctacaataaaattcatatgggcaattgtgctgagaacaccgcgaagaag
ctgagtatctcgcgggaggagcaggataagtacgccatcggctcttacacccgaagtaaa
gaggcgtgggatgcagggaagtttgcaaatgagattacgcccatcaccatctcagtgaaa
ggtaaaccagacgtggtggtgaaggaagatgaagagtacaagcgagttgacttcagtaaa
gtgccaaagctcaagacagtgttccagaaagaaaacggcacagtaacagctgctaacgcc
agcacactgaacgatggagcagctgctgtggttctcatgactgcagaggcagcccagagg
ctcaaggttaagccactggcacgaatcgcagcatttgctgatgctgctgtagaccccatt
gatttcccactcgcacctgcatatgctgtacctaaggttcttaaatatgcaggactgaaa
aaagaagacattgccatgtgggaagtaaatgaagcattcagtgtggttgtactagccaac
attaaaatgctggagattgaccctcaaaaagtaaatgtccatggaggagctgtttctctg
ggccatccaatcgggatgtctggagctcggattgttgttcacttggctcatgccttgaag
caaggagaattcggtctggctagtatttgcaatggaggaggaggggcttccgccgtgctg
attgagaagctgtag

DBGET integrated database retrieval system