KEGG   Rattus norvegicus (rat): 25014Help
Entry
25014             CDS       T01003                                 

Gene name
Acat1, RATACAL
Definition
(RefSeq) acetyl-CoA acetyltransferase 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno00072  Synthesis and degradation of ketone bodies
rno00280  Valine, leucine and isoleucine degradation
rno00310  Lysine degradation
rno00380  Tryptophan metabolism
rno00620  Pyruvate metabolism
rno00630  Glyoxylate and dicarboxylate metabolism
rno00640  Propanoate metabolism
rno00650  Butanoate metabolism
rno00900  Terpenoid backbone biosynthesis
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno01212  Fatty acid metabolism
Module
rno_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    25014 (Acat1)
   00630 Glyoxylate and dicarboxylate metabolism
    25014 (Acat1)
   00640 Propanoate metabolism
    25014 (Acat1)
   00650 Butanoate metabolism
    25014 (Acat1)
  Lipid metabolism
   00071 Fatty acid degradation
    25014 (Acat1)
   00072 Synthesis and degradation of ketone bodies
    25014 (Acat1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    25014 (Acat1)
   00310 Lysine degradation
    25014 (Acat1)
   00380 Tryptophan metabolism
    25014 (Acat1)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    25014 (Acat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     25014 (Acat1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25014 (Acat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 25014
NCBI-ProteinID: NP_058771
RGD: 2016
Ensembl: ENSRNOG00000007862
UniProt: P17764
Position
8q24
AA seq 424 aa AA seqDB search
MAALAVLHGVVRRPLLRGLLQEVRCLGRSYASKPTLNDVVIVSATRTPIGSFLGSLASQP
ATKLGTIAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAPTRQATLGAGLPIATPCTTVN
KVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDG
LTDVYNKIHMGNCAENTAKKLSISREEQDKYAIGSYTRSKEAWDAGKFANEITPITISVK
GKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAAVVLMTAEAAQR
LKVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLAN
IKMLEIDPQKVNVHGGAVSLGHPIGMSGARIVVHLAHALKQGEFGLASICNGGGGASAVL
IEKL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctggcggttctacacggcgtcgtccgcaggcctctgctccgcgggctgctg
caggaagtaagatgcctgggacgaagttatgcatccaaacccactttgaatgatgtggtt
atagtgagtgctacacgaactcccattggatccttcctgggcagccttgcctctcagcca
gccaccaagcttggtactattgcaattcagggagccattgaaaaggcagggattccaaaa
gaagaagtgaaggaggtctacatgggcaacgtcatccaagggggagaaggacaggccccg
accaggcaagctacactgggtgcaggtctacccattgccactccgtgcaccacagtaaac
aaggtgtgtgcctcaggaatgaaagccatcatgatggcctctcaaagtcttatgtgtgga
caccaggatgtgatggtggcaggcggaatggagagcatgtcaaatgtcccgtacgtaatg
agcagaggagcaacaccatacggtggggtaaaacttgaagacctgattgtgaaagacggg
ctaaccgatgtctacaataaaattcatatgggcaattgtgctgagaacaccgcgaagaag
ctgagtatctcgcgggaggagcaggataagtacgccatcggctcttacacccgaagtaaa
gaggcgtgggatgcagggaagtttgcaaatgagattacgcccatcaccatctcagtgaaa
ggtaaaccagacgtggtggtgaaggaagatgaagagtacaagcgagttgacttcagtaaa
gtgccaaagctcaagacagtgttccagaaagaaaacggcacagtaacagctgctaacgcc
agcacactgaacgatggagcagctgctgtggttctcatgactgcagaggcagcccagagg
ctcaaggttaagccactggcacgaatcgcagcatttgctgatgctgctgtagaccccatt
gatttcccactcgcacctgcatatgctgtacctaaggttcttaaatatgcaggactgaaa
aaagaagacattgccatgtgggaagtaaatgaagcattcagtgtggttgtactagccaac
attaaaatgctggagattgaccctcaaaaagtaaatgtccatggaggagctgtttctctg
ggccatccaatcgggatgtctggagctcggattgttgttcacttggctcatgccttgaag
caaggagaattcggtctggctagtatttgcaatggaggaggaggggcttccgccgtgctg
attgagaagctgtag

DBGET integrated database retrieval system