KEGG   Rattus norvegicus (rat): 25028Help
Entry
25028             CDS       T01003                                 

Gene name
Ampd1, Ampd01, RATAMPD01
Definition
(RefSeq) adenosine monophosphate deaminase 1
  KO
K01490  
AMP deaminase [EC:3.5.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    25028 (Ampd1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.6  AMP deaminase
     25028 (Ampd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q34
AA seq 747 aa AA seqDB search
MPLFKLTGQGKQIDDAMRSFAEKVFASEVKDEGGRHEISPFDVDEICPISLREMQAHIFH
MENLSMSMDGRRKRRFQGRKTVNLSIPQSETSSTKLSHIEEFISSSPTYESVPDFQRVQI
TGDYASGVTVEDFEVVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEALVAIESF
YPVFTPPPKKGEDPFRREDLPANLGYHLKMKGGVIYIYPDEAAASRDEPKPYPYPNLDDF
LDDMNFLLALIAQGPVKTYTHRRLKFLSSKFQVHQMLNEMDELKELKNNPHRDFYNCRKV
DTHIHAAACMNQKHLLRFIKKSYHIDADRVVYSTKEKNLTLKELFAQLNMHPYDLTVDSL
DVHAGRQTFQRFDKFNDKYNPVGASELRDLYLKTDNYINGEYFATIIKEVGADLVDAKYQ
HAEPRLSIYGRSPDEWSKLSSWFVGNRIYCPNMTWMIQVPRIYDVFRSKNFLPHFGKMLE
NIFLPVFEATINPQTHPDLSVFLKHITGFDSVDDESKHSGHMFSSKSPKPEEWTMENNPS
YTYYAYYMYANIMVLNCLRKERGMNTFLFRPHCGEAGALTHLMTAFMIADNISHGLNLKK
SPVLQYLFFLAQIPIAMSPLSNNSLFLEYAKNPFLDFLQKGLMISLSTDDPMQFHFTKEP
LMEEYAIAAQVFKLSTCDMCEVARNSVLQCGISHEEKAKFLGNNYLEEGPVGNDIRRTNV
AQIRMAYRYETWCYELNLIAEGLKSTE
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgttcaaacttacaggtcaaggaaaacaaattgatgatgcaatgcgtagcttt
gctgaaaaagtatttgcctcagaagtcaaagatgagggaggtcggcacgagatctccccc
ttcgacgtggatgagatctgcccaatttcccttcgtgagatgcaggcccacatattccac
atggagaacctgtccatgtccatggatggcaggaggaaaaggcgcttccaaggacggaag
actgttaatttgtccattccgcaaagtgaaacgtcttctaccaaactgtcccacattgaa
gaatttatttcttcatccccgacctatgagagtgtgcctgacttccagagggtgcagatc
actggtgactatgcctctggggtaactgttgaagactttgaggtggtttgtaaaggtctc
tatcgggctttgtgtatacgagagaaatacatgcagaagtcattccagaggttccccaag
accccctccaagtacctgaggaacatcgacggcgaagctttggtagcaatcgaaagcttc
tatccagtatttacccctcctccgaagaagggagaagacccctttcgcagagaagacctt
cccgcaaacctgggctatcacctcaagatgaagggtggtgtgatttacatctaccctgat
gaagcagcagccagcagagatgagcccaagccctacccttacccaaatctggatgacttc
ctggatgacatgaattttttgcttgctctaattgcacaagggcctgtgaagacttacact
caccgccgtctgaagttcctctcctccaagttccaggtccatcagatgctgaatgagatg
gacgagctaaaggagctgaagaacaacccccaccgggacttttataactgcaggaaggtg
gatactcacatccacgcagctgcctgcatgaaccagaagcacctgctgcgctttattaag
aaatcttaccatattgatgctgacagagtggtctacagcaccaaagagaagaacctgacc
ctgaaggaactttttgctcaattaaatatgcatccatatgacctgactgttgactctctg
gatgttcatgctggacggcagacgttccaacgcttcgataagttcaatgacaaatacaat
ccggtgggtgcgagtgagcttcgggacctctacctaaaaacagacaactacattaacgga
gagtattttgccactatcatcaaggaggtgggtgcagacctggtggacgccaagtatcag
catgcggagccccgcttgtccatctacggtcgcagtccagatgagtggagcaaactctcc
tcttggtttgtcggcaaccgtatttattgccccaacatgacatggatgatccaagtcccc
aggatctatgatgtgttccgatccaagaatttcctgccacactttggaaagatgctggag
aatattttccttccagtgtttgaggccaccatcaacccccagactcatccagacctcagt
gtcttcctcaagcatatcactggctttgacagtgtggatgatgagtccaaacacagtggt
cacatgttttcctccaagagtcccaaacctgaggagtggacaatggaaaacaacccgtct
tacacatattatgcctactacatgtatgcaaacatcatggtgctcaactgcctgagaaag
gaacgaggcatgaatacatttttgtttcgcccccattgtggtgaggctggggctctcact
cacctcatgacagcctttatgatagcggacaatatttcgcacggcctgaacttaaagaag
agtcctgtgttacagtacctatttttcttagcccagatccccattgcaatgtcgccattg
agtaacaacagcctgttcctcgaatatgcaaaaaaccctttcttagatttcctccagaaa
ggcctcatgatctcgctgtcgaccgatgacccgatgcagttccatttcaccaaggagccc
ctgatggaagagtacgccatcgcagcccaggtcttcaagctgagcacttgtgacatgtgt
gaggtggcaaggaacagtgtcctgcagtgtggaatttctcatgaggaaaaagcaaagttt
ctgggcaacaattaccttgaggaaggtcctgttggaaatgacatccgaaggacaaatgtg
gctcagattcgcatggcctatcgttatgaaacttggtgttatgaactcaatttgattgct
gagggccttaaatcaacagaatga

DBGET integrated database retrieval system