KEGG   Rattus norvegicus (rat): 25033Help
Entry
25033             CDS       T01003                                 

Gene name
Sstr1, Gpcrrna
Definition
(RefSeq) somatostatin receptor 1
  KO
K04217  
somatostatin receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    25033 (Sstr1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25033 (Sstr1)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Somatostatin
    25033 (Sstr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q23
AA seq 391 aa AA seqDB search
MFPNGTAPSPTSSPSSSPGGCGEGVCSRGPGSGAADGMEEPGRNSSQNGTLSEGQGSAIL
ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
RAYSVEDFQPENLESGGVFRNGTCASRISTL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttccccaatggcaccgccccctctcccacctcttctcccagctccagcccaggcggc
tgcggggaaggagtctgcagcaggggtcccgggtccggcgctgcggacggcatggaagaa
cctggacgaaactcttcccagaacgggactttaagcgagggtcagggtagcgccattctc
atctctttcatctactccgtggtatgcttggtgggactgtgtgggaactccatggtcatt
tacgtgatcctgcgctacgccaagatgaagaccgcaaccaacatctacattctaaacctg
gccattgctgatgagctgctcatgctcagcgtgccctttctggtcacttccacgctgttg
cgccactggccctttggcgcgctactttgccgcctggtgctcagcgtggatgcagtcaac
atgttcaccagcatctactgtctgactgtgcttagtgtggaccgctatgtggctgtggtg
cacccgatcaaggcagcgcgctaccgtcggcccactgtggccaaagtagtgaacctgggc
gtgtgggtgctgtcgctactggttatcttgcccatcgtggtcttctcacgcaccgcagcc
aacagcgatggcacggtggcctgcaacatgctcatgcccgagcccgcccagcgctggttg
gtgggcttcgtcttatacacatttctcatgggcttcctgctgcctgtcggggccatctgc
ctgtgttacgtgctcatcattgccaagatgcgcatggtggccctcaaggccggctggcag
cagcgcaagcgctcagagcgcaagatcactctaatggtgatgatggtggtgatggttttt
gtcatctgctggatgcctttctacgtggtacagctagtcaacgtgttcgccgagcaagac
gacgccacggtgagccagttgtctgtcatcctcggctatgccaatagctgtgccaacccc
atcctctacggcttcctgtcggacaacttcaagcgctctttccagcgcatcctgtgcctc
agctggatggataacgctgcggaggagcctgttgactactacgccactgccctgaagagt
cgtgcctacagtgtggaggacttccagcctgagaatctggaatctggaggcgttttccgt
aatggcacctgcgcttccaggatcagcacgctttga

DBGET integrated database retrieval system