KEGG   Rattus norvegicus (rat): 25053Help
Entry
25053             CDS       T01003                                 

Gene name
Cyp2d2, Cyp2d26
Definition
cytochrome P450, family 2, subfamily d, polypeptide 2 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    25053 (Cyp2d2)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    25053 (Cyp2d2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     25053 (Cyp2d2)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   25053 (Cyp2d2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 500 aa AA seqDB search
MGLLIGDDLWAVVIFTAIFLLLVDLVHRHKFWTAHYPPGPVPLPGLGNLLQVDFENMPYS
LYKLRSRYGDVFSLQIAWKPVVVINGLKAVRELLVTYGEDTADRPLLPIYNHLGYGDKSK
GVVLAPYGPEWREQRRFSVSTLRDFGVGKKSLEQWVTEEAGHLCDTFAKEAEHPFNPSIL
LSKAVSNVIASLVYARRFEYEDPFFNRMLKTLKESFGEDTGFMAEVLNAIPILLQIPGLP
GKVFPKLNSFIALVDKMLIEHKKSWDPAQPPRDMTDAFLAEMQKAKGNPESSFNDENLRL
VVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHEEIDEVIGQVRRPEMADQARMPFTN
AVIHEVQRFADIVPTNIPHMTSRDIKFQGFLIPKGTTLIPNLSSVLKDETVWEKPLRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVLAGRPRPST
HGVYALPVTPQPYQLCAVAR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgattggagatgacctctgggctgtggtcatattcacagccatcttcttg
cttctggtggacctggtgcaccggcacaaattctggactgcccactaccctcccggccct
gtgccactccctgggctgggaaacctgctgcaggtggactttgagaacatgccatatagc
ttatacaagcttcgaagccgctatggtgacgtgttcagcctacagatagcctggaagcct
gtagttgtgatcaacgggctgaaggccgtgcgggaactgctggtgacctatggagaggac
actgctgaccgccccctactgcccatctataatcacctgggctatggggacaaatcaaaa
ggtgtggtccttgcaccttacggacctgagtggcgagagcagagacgattctctgtgtcc
accctgcgtgacttcggcgtgggcaagaaatcgctggagcagtgggtgacagaggaggcc
ggccacctctgtgacaccttcgccaaggaggctgaacatcccttcaatcccagcatcctc
ctgagtaaggctgtgagcaacgtgattgcctcccttgtttatgctcgtcgatttgagtat
gaggaccctttcttcaacaggatgctcaaaacattgaaggagagctttggagaggacacc
ggcttcatggcagaggtgctgaacgcaatcccaattctccttcagattcctgggctgcct
ggcaaagtcttccccaagctcaattcatttatagccttagtggataagatgttaattgag
cacaagaaaagctgggatcctgcccagccgccccgagacatgactgatgccttcctagca
gagatgcaaaaggccaaggggaatcctgagagcagcttcaatgatgaaaatctgcgcttg
gtggtgattgacctgttcatggcggggatggtgaccacctcaaccacactgtcctgggcc
cttctgctcatgatcctgcatccagatgtgcagcgccgagtccacgaggagattgatgag
gtcatagggcaggtgcgtcgtccagagatggcagaccaggcacgaatgccgttcaccaat
gctgtcatccatgaggtgcagcgctttgcagacatcgtcccgacaaatataccacatatg
acatcccgagacattaaattccaaggcttcctcatccccaaggggacaaccctcatcccc
aacctgtcctccgtgctgaaggatgagactgtctgggagaagcccctccgcttccatcca
gaacacttcctggatgcccagggcaactttgtgaagcatgaggccttcatgccattctca
gcaggccgcagagcatgcctgggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttctcggtgctggccggccggccccggcccagcacc
catggcgtctacgcattgccagttactccacagccttaccaactctgtgcagtggctcgc
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system