KEGG   Rattus norvegicus (rat): 25053Help
Entry
25053             CDS       T01003                                 

Gene name
Cyp2d2, Cyp2d26
Definition
cytochrome P450, family 2, subfamily d, polypeptide 2 (EC:1.14.14.1)
Orthology
K07414  
cytochrome P450, family 2, subfamily D [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Serotonergic synapse
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:rno00140]
Organismal Systems; Nervous system; Serotonergic synapse [PATH:rno04726]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 500 aa AA seqDB search
MGLLIGDDLWAVVIFTAIFLLLVDLVHRHKFWTAHYPPGPVPLPGLGNLLQVDFENMPYS
LYKLRSRYGDVFSLQIAWKPVVVINGLKAVRELLVTYGEDTADRPLLPIYNHLGYGDKSK
GVVLAPYGPEWREQRRFSVSTLRDFGVGKKSLEQWVTEEAGHLCDTFAKEAEHPFNPSIL
LSKAVSNVIASLVYARRFEYEDPFFNRMLKTLKESFGEDTGFMAEVLNAIPILLQIPGLP
GKVFPKLNSFIALVDKMLIEHKKSWDPAQPPRDMTDAFLAEMQKAKGNPESSFNDENLRL
VVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHEEIDEVIGQVRRPEMADQARMPFTN
AVIHEVQRFADIVPTNIPHMTSRDIKFQGFLIPKGTTLIPNLSSVLKDETVWEKPLRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVLAGRPRPST
HGVYALPVTPQPYQLCAVAR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgattggagatgacctctgggctgtggtcatattcacagccatcttcttg
cttctggtggacctggtgcaccggcacaaattctggactgcccactaccctcccggccct
gtgccactccctgggctgggaaacctgctgcaggtggactttgagaacatgccatatagc
ttatacaagcttcgaagccgctatggtgacgtgttcagcctacagatagcctggaagcct
gtagttgtgatcaacgggctgaaggccgtgcgggaactgctggtgacctatggagaggac
actgctgaccgccccctactgcccatctataatcacctgggctatggggacaaatcaaaa
ggtgtggtccttgcaccttacggacctgagtggcgagagcagagacgattctctgtgtcc
accctgcgtgacttcggcgtgggcaagaaatcgctggagcagtgggtgacagaggaggcc
ggccacctctgtgacaccttcgccaaggaggctgaacatcccttcaatcccagcatcctc
ctgagtaaggctgtgagcaacgtgattgcctcccttgtttatgctcgtcgatttgagtat
gaggaccctttcttcaacaggatgctcaaaacattgaaggagagctttggagaggacacc
ggcttcatggcagaggtgctgaacgcaatcccaattctccttcagattcctgggctgcct
ggcaaagtcttccccaagctcaattcatttatagccttagtggataagatgttaattgag
cacaagaaaagctgggatcctgcccagccgccccgagacatgactgatgccttcctagca
gagatgcaaaaggccaaggggaatcctgagagcagcttcaatgatgaaaatctgcgcttg
gtggtgattgacctgttcatggcggggatggtgaccacctcaaccacactgtcctgggcc
cttctgctcatgatcctgcatccagatgtgcagcgccgagtccacgaggagattgatgag
gtcatagggcaggtgcgtcgtccagagatggcagaccaggcacgaatgccgttcaccaat
gctgtcatccatgaggtgcagcgctttgcagacatcgtcccgacaaatataccacatatg
acatcccgagacattaaattccaaggcttcctcatccccaaggggacaaccctcatcccc
aacctgtcctccgtgctgaaggatgagactgtctgggagaagcccctccgcttccatcca
gaacacttcctggatgcccagggcaactttgtgaagcatgaggccttcatgccattctca
gcaggccgcagagcatgcctgggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcagcgcttcagcttctcggtgctggccggccggccccggcccagcacc
catggcgtctacgcattgccagttactccacagccttaccaactctgtgcagtggctcgc
tag

DBGET integrated database retrieval system