KEGG   Rattus norvegicus (rat): 25080Help
Entry
25080             CDS       T01003                                 

Gene name
Apoa4, Apo-AIV, ApoA-IV, apoAIV
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  apolipoprotein A-IV
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04975  Fat digestion and absorption
rno04977  Vitamin digestion and absorption
rno04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    25080 (Apoa4)
   04979 Cholesterol metabolism
    25080 (Apoa4)
   04977 Vitamin digestion and absorption
    25080 (Apoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein YtxH Baculo_PEP_C Gp58 ApoLp-III DUF4795 DUF883 ApoA-II SF-assemblin Apo-CIII AAA_32 DUF445 Phasin Prominin BshC CorA Imm49 MAAL_C Exonuc_VII_L DUF1664 Sec2p FAM184 DUF4407 DUF72 ANAPC4 ZYG-11_interact DUF948
Motif
Other DBs
NCBI-GeneID: 25080
NCBI-ProteinID: NP_036869
RGD: 2132
Ensembl: ENSRNOG00000055909
UniProt: P02651
Position
8q22
AA seq 391 aa AA seqDB search
MFLKAVVLTVALVAITGTQAEVTSDQVANVMWDYFTQLSNNAKEAVEQLQKTDVTQQLNT
LFQDKLGNINTYADDLQNKLVPFAVQLSGHLTKETERVREEIQKELEDLRANMMPHANKV
SQMFGDNVQKLQEHLRPYATDLQAQINAQTQDMKRQLTPYIQRMQTTIQDNVENLQSSMV
PFANELKEKFNQNMEGLKGQLTPRANELKATIDQNLEDLRSRLAPLAEGVQEKLNHQMEG
LAFQMKKNAEELHTKVSTNIDQLQKNLAPLVEDVQSKLKGNTEGLQKSLEDLNKQLDQQV
EVFRRAVEPLGDKFNMALVQQMEKFRQQLGSDSGDVESHLSFLEKNLREKVSSFMSTLQK
KGSPDQPLALPLPEQVQEQVQEQVQPKPLES
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtgctgaccgtggccctggtggccatcaccgggacccaggct
gaggtcacttccgaccaggtggccaatgtgatgtgggactacttcacccagctaagcaac
aatgccaaggaggctgtggaacaactgcagaagacagatgtcactcaacagctcaatacc
ctcttccaggacaaacttgggaacattaacacctatgccgatgacctgcagaacaagctg
gtgcccttcgccgttcaactgagtggacatctaaccaaggaaacagagagggtgagggaa
gagatccagaaggagctcgaggacctacgggccaacatgatgccccatgccaacaaagtg
agccagatgttcggggacaacgtgcagaagttgcaggaacacctgaggccctatgccacg
gacctgcaagctcagatcaacgcacagacccaggatatgaaacgccagctgaccccctac
atccagcgcatgcagaccacaatacaagacaatgtggaaaacctgcagtcctccatggtg
ccctttgccaacgagctaaaggaaaagtttaaccagaatatggaagggctcaaggggcaa
ctaaccccccgtgccaacgagctgaaggccacgatcgaccagaacctggaagacctgcgc
agcagactggcccctctcgcggagggtgtgcaggaaaaactcaaccatcagatggaaggc
ttggccttccagatgaagaagaacgctgaggagctccataccaaagtctccacaaatatc
gaccagctgcagaagaatctggccccgctggtggaagatgtgcaaagcaagctgaaaggc
aacacggaaggactgcagaagtctctggaagacctgaacaagcagctggaccagcaggtg
gaggtgttccggcgtgctgtggagcccctgggggataagttcaacatggctctggtgcag
cagatggagaagttcaggcagcagctgggctccgattcgggggacgtggaaagccacttg
agcttcctggagaagaacctgagggaaaaggtcagctcctttatgagcaccctgcaaaaa
aaggggagcccagaccagcccctagccctccccctcccggagcaggttcaggaacaggtc
caggagcaggtgcagcccaaacctctggagagctga

DBGET integrated database retrieval system