KEGG   Rattus norvegicus (rat): 25080Help
Entry
25080             CDS       T01003                                 

Gene name
Apoa4, Apo-AIV, ApoA-IV, apoAIV
Definition
(RefSeq) apolipoprotein A4
  KO
K08760  
apolipoprotein A-IV
Organism
rno  Rattus norvegicus (rat)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    25080 (Apoa4)
   04979 Cholesterol metabolism
    25080 (Apoa4)
   04977 Vitamin digestion and absorption
    25080 (Apoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q22
AA seq 391 aa AA seqDB search
MFLKAVVLTVALVAITGTQAEVTSDQVANVMWDYFTQLSNNAKEAVEQLQKTDVTQQLNT
LFQDKLGNINTYADDLQNKLVPFAVQLSGHLTKETERVREEIQKELEDLRANMMPHANKV
SQMFGDNVQKLQEHLRPYATDLQAQINAQTQDMKRQLTPYIQRMQTTIQDNVENLQSSMV
PFANELKEKFNQNMEGLKGQLTPRANELKATIDQNLEDLRSRLAPLAEGVQEKLNHQMEG
LAFQMKKNAEELHTKVSTNIDQLQKNLAPLVEDVQSKLKGNTEGLQKSLEDLNKQLDQQV
EVFRRAVEPLGDKFNMALVQQMEKFRQQLGSDSGDVESHLSFLEKNLREKVSSFMSTLQK
KGSPDQPLALPLPEQVQEQVQEQVQPKPLES
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtgctgaccgtggccctggtggccatcaccgggacccaggct
gaggtcacttccgaccaggtggccaatgtgatgtgggactacttcacccagctaagcaac
aatgccaaggaggctgtggaacaactgcagaagacagatgtcactcaacagctcaatacc
ctcttccaggacaaacttgggaacattaacacctatgccgatgacctgcagaacaagctg
gtgcccttcgccgttcaactgagtggacatctaaccaaggaaacagagagggtgagggaa
gagatccagaaggagctcgaggacctacgggccaacatgatgccccatgccaacaaagtg
agccagatgttcggggacaacgtgcagaagttgcaggaacacctgaggccctatgccacg
gacctgcaagctcagatcaacgcacagacccaggatatgaaacgccagctgaccccctac
atccagcgcatgcagaccacaatacaagacaatgtggaaaacctgcagtcctccatggtg
ccctttgccaacgagctaaaggaaaagtttaaccagaatatggaagggctcaaggggcaa
ctaaccccccgtgccaacgagctgaaggccacgatcgaccagaacctggaagacctgcgc
agcagactggcccctctcgcggagggtgtgcaggaaaaactcaaccatcagatggaaggc
ttggccttccagatgaagaagaacgctgaggagctccataccaaagtctccacaaatatc
gaccagctgcagaagaatctggccccgctggtggaagatgtgcaaagcaagctgaaaggc
aacacggaaggactgcagaagtctctggaagacctgaacaagcagctggaccagcaggtg
gaggtgttccggcgtgctgtggagcccctgggggataagttcaacatggctctggtgcag
cagatggagaagttcaggcagcagctgggctccgattcgggggacgtggaaagccacttg
agcttcctggagaagaacctgagggaaaaggtcagctcctttatgagcaccctgcaaaaa
aaggggagcccagaccagcccctagccctccccctcccggagcaggttcaggaacaggtc
caggagcaggtgcagcccaaacctctggagagctga

DBGET integrated database retrieval system