KEGG   Rattus norvegicus (rat): 25080Help
Entry
25080             CDS       T01003                                 

Gene name
Apoa4, Apo-AIV, ApoA-IV, apoAIV
Definition
apolipoprotein A-IV
Orthology
K08760  
apolipoprotein A-IV
Organism
rno  Rattus norvegicus (rat)
Pathway
Fat digestion and absorption
Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    25080 (Apoa4)
   04977 Vitamin digestion and absorption
    25080 (Apoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
8q22
AA seq 391 aa AA seqDB search
MFLKAVVLTVALVAITGTQAEVTSDQVANVMWDYFTQLSNNAKEAVEQLQKTDVTQQLNT
LFQDKLGNINTYADDLQNKLVPFAVQLSGHLTKETERVREEIQKELEDLRANMMPHANKV
SQMFGDNVQKLQEHLRPYATDLQAQINAQTQDMKRQLTPYIQRMQTTIQDNVENLQSSMV
PFANELKEKFNQNMEGLKGQLTPRANELKATIDQNLEDLRSRLAPLAEGVQEKLNHQMEG
LAFQMKKNAEELHTKVSTNIDQLQKNLAPLVEDVQSKLKGNTEGLQKSLEDLNKQLDQQV
EVFRRAVEPLGDKFNMALVQQMEKFRQQLGSDSGDVESHLSFLEKNLREKVSSFMSTLQK
KGSPDQPLALPLPEQVQEQVQEQVQPKPLES
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaaggctgtggtgctgaccgtggccctggtggccatcaccgggacccaggct
gaggtcacttccgaccaggtggccaatgtgatgtgggactacttcacccagctaagcaac
aatgccaaggaggctgtggaacaactgcagaagacagatgtcactcaacagctcaatacc
ctcttccaggacaaacttgggaacattaacacctatgccgatgacctgcagaacaagctg
gtgcccttcgccgttcaactgagtggacatctaaccaaggaaacagagagggtgagggaa
gagatccagaaggagctcgaggacctacgggccaacatgatgccccatgccaacaaagtg
agccagatgttcggggacaacgtgcagaagttgcaggaacacctgaggccctatgccacg
gacctgcaagctcagatcaacgcacagacccaggatatgaaacgccagctgaccccctac
atccagcgcatgcagaccacaatacaagacaatgtggaaaacctgcagtcctccatggtg
ccctttgccaacgagctaaaggaaaagtttaaccagaatatggaagggctcaaggggcaa
ctaaccccccgtgccaacgagctgaaggccacgatcgaccagaacctggaagacctgcgc
agcagactggcccctctcgcggagggtgtgcaggaaaaactcaaccatcagatggaaggc
ttggccttccagatgaagaagaacgctgaggagctccataccaaagtctccacaaatatc
gaccagctgcagaagaatctggccccgctggtggaagatgtgcaaagcaagctgaaaggc
aacacggaaggactgcagaagtctctggaagacctgaacaagcagctggaccagcaggtg
gaggtgttccggcgtgctgtggagcccctgggggataagttcaacatggctctggtgcag
cagatggagaagttcaggcagcagctgggctccgattcgggggacgtggaaagccacttg
agcttcctggagaagaacctgagggaaaaggtcagctcctttatgagcaccctgcaaaaa
aaggggagcccagaccagcccctagccctccccctcccggagcaggttcaggaacaggtc
caggagcaggtgcagcccaaacctctggagagctga

DBGET integrated database retrieval system