KEGG   Rattus norvegicus (rat): 25086Help
Entry
25086             CDS       T01003                                 

Gene name
Cyp2e1, Cyp2e
Definition
cytochrome P450, family 2, subfamily e, polypeptide 1 (EC:1.14.13.n7)
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    25086 (Cyp2e1)
   00590 Arachidonic acid metabolism
    25086 (Cyp2e1)
   00591 Linoleic acid metabolism
    25086 (Cyp2e1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25086 (Cyp2e1)
   00982 Drug metabolism - cytochrome P450
    25086 (Cyp2e1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    25086 (Cyp2e1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25086 (Cyp2e1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     25086 (Cyp2e1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   25086 (Cyp2e1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q41-q42
AA seq 493 aa AA seqDB search
MAVLGITIALLVWVATLLVISIWKKIYNSWNLPPGPFPLPILGNIFQLDLKDIPKSFTKL
AKRFGPVFTLHLGSRRIVVLHGYKAVKEVLLNHKNEFSGRGDIPVFQEYKNKGIIFNNGP
TWKDVRRFSLSILRDWGMGKQGNEARIQREAQFLVEELKKTKGQPFDPTFLIGCAPCNVI
ADILFNKRFDYNDKKCLRLMSLFNENFYLLSTPWIQLYNNFADYLRYLPGSHRKIMKNVS
EIKQYTLEKAKEHLQSLDINCARDVTDCLLIEMEKEKHSQEPMYTMENVSVTLADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRVPAVRDRLDMPYMDAVVHEIQRF
INLVPSNLPHEATRDTVFQGYVIPKGTVVIPTLDSLLYDSHEFPDPEKFKPEHFLNENGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLLLSAILQHFNLKSLVDPKDIDLSPVTVGFGS
IPPQFKLCVIPRS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcttggcatcaccattgccttgctggtgtgggtggccaccctcctcgtcata
tccatctggaagaagatctataacagttggaacctgcccccaggacctttccctcttccc
atccttgggaacatttttcagctggatttgaaggatatccccaagtctttcaccaagttg
gcaaagcgcttcgggccagtgttcacactgcaccttggctcaaggcgcatcgtggtcctg
catggctacaaggctgtcaaggaggtgctactgaaccacaagaatgagttttctggacgg
ggggacattcctgtgttccaggagtacaagaacaaggggattattttcaataatgggccc
acatggaaggatgtgcggaggttttccctaagcattctccgagactggggaatggggaaa
cagggtaatgaggcccgcatccaaagggaggcgcaattcctggtggaggagctcaaaaag
accaaaggccagccttttgaccccacatttctgattggctgcgcaccctgcaatgtcatt
gcggatatcctcttcaacaaacgtttcgactacaatgacaagaagtgtctgaggctcatg
agtttgttcaatgaaaacttctacctgctgagcaccccctggatccagctttacaataac
tttgcggattatctacgatacctacctggaagccatagaaaaatcatgaaaaatgtgtct
gaaataaaacagtacacacttgaaaaagccaaggaacaccttcagtcactggacatcaac
tgcgcccgggatgtgactgactgtctcctcatagagatggagaaggaaaaacacagccaa
gaacccatgtacacaatggaaaatgtttctgtgactttggccgacctgttctttgcagga
actgagaccaccagcacaactctgagatatgggctcctgatcctcatgaaatacccagaa
attgaagagaaacttcatgaagaaattgacagggttattgggccaagccgcgtccctgct
gtcagagacagactggatatgccctacatggatgctgtggtgcatgagatccagagattc
atcaatcttgtcccttccaacctaccccatgaagcaaccagagatactgtgttccaagga
tatgtcatccccaagggtacagttgtgattccaactctggactccctcttatatgacagc
catgagtttccagatccagagaagtttaaacctgagcatttcctgaatgaaaatgggaag
ttcaagtacagtgactatttcaaggcattttctgcaggaaagcgtgtgtgtgttggagaa
ggcctggcccgcatggaattgtttctgctcctgtctgctattctgcagcattttaacctg
aagtctctggttgaccctaaggatatcgacctcagtcctgtcacagttggctttggcagt
atcccaccccaatttaaactctgtgtcattccccgttcatga

DBGET integrated database retrieval system