KEGG   Rattus norvegicus (rat): 25086Help
Entry
25086             CDS       T01003                                 

Gene name
Cyp2e1, Cyp2e
Definition
cytochrome P450, family 2, subfamily e, polypeptide 1 (EC:1.14.13.n7)
Orthology
K07415  
cytochrome P450, family 2, subfamily E, polypeptide 1 [EC:1.14.13.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Non-alcoholic fatty liver disease (NAFLD)
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:rno00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:rno00591]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:rno00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:rno00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:rno05204]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:rno04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q41-q42
AA seq 493 aa AA seqDB search
MAVLGITIALLVWVATLLVISIWKKIYNSWNLPPGPFPLPILGNIFQLDLKDIPKSFTKL
AKRFGPVFTLHLGSRRIVVLHGYKAVKEVLLNHKNEFSGRGDIPVFQEYKNKGIIFNNGP
TWKDVRRFSLSILRDWGMGKQGNEARIQREAQFLVEELKKTKGQPFDPTFLIGCAPCNVI
ADILFNKRFDYNDKKCLRLMSLFNENFYLLSTPWIQLYNNFADYLRYLPGSHRKIMKNVS
EIKQYTLEKAKEHLQSLDINCARDVTDCLLIEMEKEKHSQEPMYTMENVSVTLADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRVPAVRDRLDMPYMDAVVHEIQRF
INLVPSNLPHEATRDTVFQGYVIPKGTVVIPTLDSLLYDSHEFPDPEKFKPEHFLNENGK
FKYSDYFKAFSAGKRVCVGEGLARMELFLLLSAILQHFNLKSLVDPKDIDLSPVTVGFGS
IPPQFKLCVIPRS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcttggcatcaccattgccttgctggtgtgggtggccaccctcctcgtcata
tccatctggaagaagatctataacagttggaacctgcccccaggacctttccctcttccc
atccttgggaacatttttcagctggatttgaaggatatccccaagtctttcaccaagttg
gcaaagcgcttcgggccagtgttcacactgcaccttggctcaaggcgcatcgtggtcctg
catggctacaaggctgtcaaggaggtgctactgaaccacaagaatgagttttctggacgg
ggggacattcctgtgttccaggagtacaagaacaaggggattattttcaataatgggccc
acatggaaggatgtgcggaggttttccctaagcattctccgagactggggaatggggaaa
cagggtaatgaggcccgcatccaaagggaggcgcaattcctggtggaggagctcaaaaag
accaaaggccagccttttgaccccacatttctgattggctgcgcaccctgcaatgtcatt
gcggatatcctcttcaacaaacgtttcgactacaatgacaagaagtgtctgaggctcatg
agtttgttcaatgaaaacttctacctgctgagcaccccctggatccagctttacaataac
tttgcggattatctacgatacctacctggaagccatagaaaaatcatgaaaaatgtgtct
gaaataaaacagtacacacttgaaaaagccaaggaacaccttcagtcactggacatcaac
tgcgcccgggatgtgactgactgtctcctcatagagatggagaaggaaaaacacagccaa
gaacccatgtacacaatggaaaatgtttctgtgactttggccgacctgttctttgcagga
actgagaccaccagcacaactctgagatatgggctcctgatcctcatgaaatacccagaa
attgaagagaaacttcatgaagaaattgacagggttattgggccaagccgcgtccctgct
gtcagagacagactggatatgccctacatggatgctgtggtgcatgagatccagagattc
atcaatcttgtcccttccaacctaccccatgaagcaaccagagatactgtgttccaagga
tatgtcatccccaagggtacagttgtgattccaactctggactccctcttatatgacagc
catgagtttccagatccagagaagtttaaacctgagcatttcctgaatgaaaatgggaag
ttcaagtacagtgactatttcaaggcattttctgcaggaaagcgtgtgtgtgttggagaa
ggcctggcccgcatggaattgtttctgctcctgtctgctattctgcagcattttaacctg
aagtctctggttgaccctaaggatatcgacctcagtcctgtcacagttggctttggcagt
atcccaccccaatttaaactctgtgtcattccccgttcatga

DBGET integrated database retrieval system