KEGG   Rattus norvegicus (rat): 25111Help
Entry
25111             CDS       T01003                                 

Gene name
Chrm4, M4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
rno  Rattus norvegicus (rat)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25111 (Chrm4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    25111 (Chrm4)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    25111 (Chrm4)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    25111 (Chrm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q32-q35
AA seq 478 aa AA seqDB search
MANFTPVNGSSANQSVRLVTAAHNHLETVEMVFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTLYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT
LAFLKSPLMKPSIKKPPPGGASREELRNGKLEEAPPPALPPPPRPVPDKDTSNESSSGSA
TQNTKERPPTELSTAEATTPALPAPTLQPRTLNPASKWSKIQIVTKQTGNECVTAIEIVP
ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL
VNTFCQSCIPERVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggccaacttcacgcctgtcaatggcagctcagccaatcagtctgtgcgcctggtcaca
gcagcccacaaccacctggagacagtggagatggtgttcattgctacagtgactggctcc
ctgagcctggtgactgttgtgggtaacatcctggtgatgctgtccatcaaggtcaacagg
cagttgcagacggtcaacaactacttcctcttcagcctggcgtgtgcggatctcatcata
ggggcattctctatgaacctctacactttgtatatcatcaagggctactggcccctgggt
gccgtggtctgtgacttgtggctggccctggactatgtggtgagcaatgcctctgtcatg
aaccttcttatcatcagcttcgatcgttacttctgcgtcaccaaacccctcacctatccc
gcccgccgcactactaagatggcaggtctcatgatcgcagctgcctgggtcttgtccttt
gtgctctgggctcctgccatcttgttctggcagtttgtggtgggcaagaggacggtgcct
gataaccagtgcttcatccagttcttgtccaacccggcagtgacctttggcaccgccatt
gctgccttctacctgcctgtggtcatcatgacggtactgtatattcacatctcactggcc
agccgcagccgcgttcacaagcatcgacctgagggccccaaggagaagaaggccaagact
ctggctttcctcaagagccctctgatgaagccgagtatcaagaaacctccaccagggggc
gcttctcgagaggaactgcgcaatgggaagctggaagaggctcctccgccagccctgccc
ccgcctccacgcccagtgcctgacaaggacacttccaatgagtccagctcaggcagtgcc
acccagaacaccaaggaacggccacccacagagctgtccaccgcagaggccaccactcca
gcgctgcctgcccctaccctgcagccacgaaccctcaacccagcctccaaatggtccaag
attcaaattgtaacaaagcagacaggcaatgaatgtgtgacggccatcgagattgtacct
gccactccagctggtatgcgcccagcagccaatgtggcccgaaagtttgccagcattgct
cgcaaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaagtgactcggaca
atctttgccattctgctggccttcatcctcacctggacaccctacaatgtcatggtcctg
gtgaacaccttttgccagagctgtatccccgagagggtgtggtccatcggctactggctc
tgctacgtcaacagcaccatcaaccccgcctgctatgcactctgcaatgccactttcaaa
aagaccttccggcaccttttgctgtgccagtatcggaacatcggcacagccaggtag

DBGET integrated database retrieval system