KEGG   Rattus norvegicus (rat): 25147Help
Entry
25147             CDS       T01003                                 

Gene name
Cyp19a1, Aromatase, Cyp19, Cyp19a, p450arom
Definition
cytochrome P450, family 19, subfamily a, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    25147 (Cyp19a1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    25147 (Cyp19a1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     25147 (Cyp19a1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP19 family
   25147 (Cyp19a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
8q23-q24
AA seq 503 aa AA seqDB search
MFLEMLNPMHYNVTIMVPETVPVSAMPLLLIMGLLLLIRNCESSSSIPGPGYCLGIGPLI
SHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKR
GLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTD
NSGYVDVVTLMRHIMLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFFKISWL
YRKYERSVKDLKDEIEILVEKKRQKVSSAEKLEDCMDFATDLIFAERRGDLTKENVNQCI
LEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVGDRDIRIGDVQNLKVVENFI
NESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLH
LDEDSPIVEIIFSPRNSEKYLKQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggaaatgctgaaccccatgcactataatgtcaccatcatggtcccggaaact
gtgcctgtcagtgccatgccacttctgctgatcatgggcctcctcctcctgattcggaat
tgtgagagctcatcttccataccaggtcctggctactgtctgggaatcgggcctctcatt
tcccatggcagattcttgtggatggggattggaagtgcctgcaactactacaataagatg
tatggagagttcatgagagtctggatcagtggagaggagacactcatcatcagcaagtcc
tcgagcatggtccatgtgatgaagcacagcaactacatctccagattcggcagcaagcgt
gggctgcagtgcattggcatgcacgagaatggcatcatatttaacaacaacccgagcctg
tggagaacggtccgccctttcttcatgaaagctctgacgggccctggtcttattcgaatg
gtagaagtctgtgtggaatccatcaagcagcatttggacaggctgggtgacgtcactgac
aactcgggctacgtggacgtggtgaccctcatgagacacatcatgctggacacttctaac
acgctcttcctggggatccccctggacgaaagttctattgtgaagaaaatccagggttat
tttaatgcctggcaagcactccttatcaaaccaaacatcttctttaagatttcttggctc
tacagaaagtatgagagatccgtcaaggacttgaaagacgagatcgaaattctggtggaa
aagaaaagacagaaagtttcctcagcagagaaactggaagactgtatggattttgcaact
gatttgattttcgctgagagacgtggagacctgacaaaggagaacgtgaatcagtgtata
ttggaaatgctgattgcggcccctgacaccatgtccgtcactctgtacgtcatgttgctt
ctcatcgcagagtatccggaggtggaaacagctatactgaaggaaatccacactgttgtt
ggtgacagagacataaggattggtgatgtgcaaaatttgaaagtggtggaaaacttcatt
aacgagagcctgcggtatcagcctgtcgtggacttggtcatgcgcagagccctggaggat
gacgtgattgacggctacccggttaaaaagggaactaacatcattctgaacatcggaaga
atgcacaggctcgagtatttccccaagcccaatgaatttacccttgaaaactttgagaag
aacgttccctacaggtattttcagccatttggctttgggccccgcagctgtgctgggaag
tacatcgccatggtgatgatgaaagttgtcctggttacacttttgaaacgattccatgtg
aagacattgcaaaaaaggtgtattgaaaatatgccgaaaaataatgacttgtccttgcat
ctagatgaggacagccccattgtggaaataattttctctccaaggaattcagaaaagtac
ctcaaacagtga

DBGET integrated database retrieval system