KEGG   Rattus norvegicus (rat): 25147Help
Entry
25147             CDS       T01003                                 

Gene name
Cyp19a1, Aromatase, Cyp19, Cyp19a, p450arom
Definition
cytochrome P450, family 19, subfamily a, polypeptide 1 (EC:1.14.14.14)
Orthology
K07434  
aromatase [EC:1.14.14.14]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Ovarian steroidogenesis
Module
C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:rno00140]
Organismal Systems; Endocrine system; Ovarian Steroidogenesis [PATH:rno04913]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
8q23-q24
AA seq 503 aa AA seqDB search
MFLEMLNPMHYNVTIMVPETVPVSAMPLLLIMGLLLLIRNCESSSSIPGPGYCLGIGPLI
SHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKR
GLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTD
NSGYVDVVTLMRHIMLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFFKISWL
YRKYERSVKDLKDEIEILVEKKRQKVSSAEKLEDCMDFATDLIFAERRGDLTKENVNQCI
LEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVGDRDIRIGDVQNLKVVENFI
NESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLH
LDEDSPIVEIIFSPRNSEKYLKQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggaaatgctgaaccccatgcactataatgtcaccatcatggtcccggaaact
gtgcctgtcagtgccatgccacttctgctgatcatgggcctcctcctcctgattcggaat
tgtgagagctcatcttccataccaggtcctggctactgtctgggaatcgggcctctcatt
tcccatggcagattcttgtggatggggattggaagtgcctgcaactactacaataagatg
tatggagagttcatgagagtctggatcagtggagaggagacactcatcatcagcaagtcc
tcgagcatggtccatgtgatgaagcacagcaactacatctccagattcggcagcaagcgt
gggctgcagtgcattggcatgcacgagaatggcatcatatttaacaacaacccgagcctg
tggagaacggtccgccctttcttcatgaaagctctgacgggccctggtcttattcgaatg
gtagaagtctgtgtggaatccatcaagcagcatttggacaggctgggtgacgtcactgac
aactcgggctacgtggacgtggtgaccctcatgagacacatcatgctggacacttctaac
acgctcttcctggggatccccctggacgaaagttctattgtgaagaaaatccagggttat
tttaatgcctggcaagcactccttatcaaaccaaacatcttctttaagatttcttggctc
tacagaaagtatgagagatccgtcaaggacttgaaagacgagatcgaaattctggtggaa
aagaaaagacagaaagtttcctcagcagagaaactggaagactgtatggattttgcaact
gatttgattttcgctgagagacgtggagacctgacaaaggagaacgtgaatcagtgtata
ttggaaatgctgattgcggcccctgacaccatgtccgtcactctgtacgtcatgttgctt
ctcatcgcagagtatccggaggtggaaacagctatactgaaggaaatccacactgttgtt
ggtgacagagacataaggattggtgatgtgcaaaatttgaaagtggtggaaaacttcatt
aacgagagcctgcggtatcagcctgtcgtggacttggtcatgcgcagagccctggaggat
gacgtgattgacggctacccggttaaaaagggaactaacatcattctgaacatcggaaga
atgcacaggctcgagtatttccccaagcccaatgaatttacccttgaaaactttgagaag
aacgttccctacaggtattttcagccatttggctttgggccccgcagctgtgctgggaag
tacatcgccatggtgatgatgaaagttgtcctggttacacttttgaaacgattccatgtg
aagacattgcaaaaaaggtgtattgaaaatatgccgaaaaataatgacttgtccttgcat
ctagatgaggacagccccattgtggaaataattttctctccaaggaattcagaaaagtac
ctcaaacagtga

DBGET integrated database retrieval system