KEGG   Rattus norvegicus (rat): 25148Help
Entry
25148             CDS       T01003                                 

Gene name
Egr3
Definition
early growth response 3
Orthology
K12497  
early growth response protein 3
Organism
rno  Rattus norvegicus (rat)
Pathway
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    25148 (Egr3)
  Infectious diseases
   05161 Hepatitis B
    25148 (Egr3)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    25148 (Egr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15cen-q11
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYTQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTTTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKSEKGGAPSASSAPTVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaatcaattg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagt
gactcggtagcccattacactcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaatccggaactctcttattcgggctctttccagccagccccaggcaac
aagaccgtgacctacttgggaaagttcgctttcgactctccttccaactggtgccaggac
aacatcattagcctcatgagtgccggcatcttgggggtgcccccggcctcaggggcgctc
agtacgcagacgaccacggctagcatggtgcagcctcctcagggagacgtggaggccatg
tatccggcgctgcccccctattccaactgcggcgacctctactcggagccggtgtctttc
cacgacccccaggggaacccagggctcgcctattccccccaggattaccaatcggccaag
ccggccttggacagcaatcttttccccatgattcctgactacaacctgtatcaccacccc
aacgacatgggctccattccagaacacaagcccttccagggcatggaccccattcgggtc
aacccaccccctattacccctctggagaccatcaaggccttcaaagacaagcagatccac
ccgggcttcggcagcttgccccaaccgccgcttactctcaagcccatccggccccgcaag
taccccaatcggcctagcaagaccccactccacgagcggccccacgcgtgtcccgcggaa
ggctgtgaccggcgtttcagccgctcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgtcggatctgcatgcgcagcttcagccgcagcgaccacctc
actactcacatccgcacgcacaccggggagaagccctttgcctgtgagttctgtgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaagtcggagaaagggggtgcgccctctgcatcctcggcgcccaccgtgtccctggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system