KEGG   Rattus norvegicus (rat): 25155Help
Entry
25155             CDS       T01003                                 

Gene name
Syk, p72syk
Definition
(RefSeq) spleen associated tyrosine kinase
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04064  NF-kappa B signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04380  Osteoclast differentiation
rno04611  Platelet activation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05152  Tuberculosis
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    25155 (Syk)
   04072 Phospholipase D signaling pathway
    25155 (Syk)
   04151 PI3K-Akt signaling pathway
    25155 (Syk)
 Organismal Systems
  Immune system
   04611 Platelet activation
    25155 (Syk)
   04625 C-type lectin receptor signaling pathway
    25155 (Syk)
   04650 Natural killer cell mediated cytotoxicity
    25155 (Syk)
   04662 B cell receptor signaling pathway
    25155 (Syk)
   04664 Fc epsilon RI signaling pathway
    25155 (Syk)
   04666 Fc gamma R-mediated phagocytosis
    25155 (Syk)
  Development
   04380 Osteoclast differentiation
    25155 (Syk)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    25155 (Syk)
  Infectious diseases
   05152 Tuberculosis
    25155 (Syk)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    25155 (Syk)
   05169 Epstein-Barr virus infection
    25155 (Syk)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25155 (Syk)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SYK family
   25155 (Syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 25155
NCBI-ProteinID: NP_036890
RGD: 3796
Ensembl: ENSRNOG00000012160
UniProt: Q64725
Position
17p14
AA seq 629 aa AA seqDB search
MAGNAVDNANHLTYFFGNITREEAEDYLVQGGMTDGLYLLRQSRNYLGGFALSVAHNRKA
HHYTIERELNGTYAISGGRAHASPADLCHYHSQEPEGLVCLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQT
VLIGSKTNGKFLIRARDNNGSFALCLLHEGKVLHYRIDRDKTGKLSIPEGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGVQMGHPGSSNAHPVTWSPGGIISRIKSYSFPKPGHKKP
PPPQGSRPESTVSFNPYEPTGGAWGPDRGLQREALPMDTEVYESPYADPEEIRPKEVYLD
RKLLTLEDNELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQ
LDNPYIVRMIGICEAESWMLVMEMAAWGPLNKYLQQNRHIKDKNIIELVHQVSMGMKYLE
ESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINY
FKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPPGCPREMYDLMF
LCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaatgctgtggacaatgccaaccacctgacctacttttttggcaacatcacc
cgggaagaggccgaagactacctggtccagggaggcatgaccgatgggctctacctgcta
cgccagagccgcaattacctgggtggttttgctttgtcggtggcacacaacaggaaggca
caccactacactatcgagagagaacttaacggcacctacgccatctccgggggcagggcc
catgccagcccggcagacctctgccattaccactcccaggaacccgaaggcctggtctgc
ctcctcaagaagcccttcaaccggcccccgggggtacagcccaagactggaccctttgag
gacctgaaggagaacctcatcagggaatatgtgaaacagacctggaaccttcagggccag
gctctggagcaagccatcataagtcagaagccccaactggagaagttgatcgccacgacg
gctcatgagaagatgccctggttccatggcaacatctccagagacgagtcagagcagacg
gtcctcatagggtcaaagaccaacggaaaattcctgatcagggccagagacaacaacggc
tcctttgcactgtgcctgctgcacgaagggaaggtattacactatcgcatcgacagggac
aagaccgggaagctttccatccccgaggggaagaagtttgacaccctctggcagctagtg
gaacattactcttacaagccagatgggctattaagagtcctcacggtaccatgtcaaaag
attggcgtgcagatgggccacccaggaagttcaaatgcccatcctgtgacttggtcacca
ggtggaataatctcaagaatcaaatcctactccttcccaaagcctggccacaaaaagcct
cccccaccccaagggagccgtccggagagcaccgtgtccttcaatccctatgagccaacg
ggaggggcctggggcccagacagaggccttcagagagaagccctgcccatggacaccgag
gtatatgagagtccttacgctgaccctgaagagatccggcccaaagaggtctacctggac
aggaaactgctgaccctggaggacaatgaactgggctctggcaacttcgggactgtgaaa
aagggatactaccaaatgaaaaaagttgtaaaaacagtggctgtgaaaatcctgaagaat
gaggccaacgacccggctctgaaggacgagctgctggcggaggccaacgtcatgcagcag
ctggacaacccctacattgtgcgcatgatcggaatctgtgaggcggagtcgtggatgctg
gtgatggagatggcggcatgggggcccctcaacaagtacctgcagcagaacaggcacatc
aaggataagaacatcatcgagctggttcaccaggtttccatgggaatgaagtatttggag
gagagcaattttgtgcacagagatctggccgcgaggaacgtgcttctggtcacccagcac
tacgccaagatcagtgacttcggtctttccaaagccctccgtgctgatgaaaactactac
aaggcccagacccacgggaagtggccggtgaagtggtacgcccccgaatgcatcaactac
tttaagttctccagtaagagtgatgtctggagcttcggagtcctgatgtgggaagcgttc
tcctacgggcagaagccatacagagggatgaaagggagcgaagtgactgccatgctggag
aaaggagagcggatggggtgccctccaggatgcccgagagagatgtacgacttgatgttc
ctatgctggacttacgatgtggagaacaggccaggattcgcggctgtggaactgcggctt
cgcaattactactacgacgtggttaactaa

DBGET integrated database retrieval system