KEGG   Rattus norvegicus (rat): 25197Help
Entry
25197             CDS       T01003                                 

Gene name
St6gal1, Siat1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    25197 (St6gal1)
   00514 Other types of O-glycan biosynthesis
    25197 (St6gal1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     25197 (St6gal1)
Glycosyltransferases [BR:rno01003]
 Terminal extension
  Sialyltransferase
   25197 (St6gal1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q23
AA seq 403 aa AA seqDB search
MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVV
FSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYK
VSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQR
CAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRF
LKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWE
LWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSA
CTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgattcataccaacttgaagaaaaagttcagcctcttcatcctggtctttctcctgttc
gcagtcatctgtgtttggaagaaagggagcgactatgaggcccttacactgcaagccaag
gaattccagatgcccaagagccaggagaaagtggccatggggtctgcttcccaggttgtg
ttctcaaacagcaagcaagaccctaaggaagacattccaatcctcagttaccacagggtc
acagccaaggtcaaaccacagccttccttccaggtgtgggacaaggactccacatactca
aaacttaaccccaggctgctgaagatctggagaaactatctgaacatgaacaaatataaa
gtatcctacaagggaccggggccaggagtcaagttcagcgtagaagcactgcgttgccac
cttcgagaccatgtgaacgtgtctatgatagaggccacagattttcccttcaacaccact
gagtgggagggttacctgcccaaggagaactttagaaccaaggttgggccttggcaaagg
tgtgccgtcgtctcttctgcaggatctctgaaaaactcccagcttggtcgagagattgat
aatcatgatgcagttctgaggtttaatggggcccctaccgacaacttccaacaggatgtg
ggctcaaaaactaccattcgcctaatgaactctcagttagtcaccacagaaaagcgcttc
ctcaaggacagtttgtacaccgaaggaatcctaattgtatgggacccatccgtgtatcat
gcagatatcccaaagtggtatcagaaaccagactacaatttcttcgaaacctataagagt
taccgaaggctgaaccccagccagccattttatatcctcaagccccagatgccatgggaa
ctgtgggacatcattcaggaaatctctgcagatctgattcagccaaatcccccatcctcc
ggcatgctgggtatcatcatcatgatgacgctgtgtgaccaggtagatatttacgagttc
ctcccatccaagcgcaagacggacgtgtgctattatcaccaaaagttctttgacagcgct
tgcacgatgggtgcctaccacccgctcctcttcgagaagaatatggtgaagcatctcaat
gagggaacagatgaagacatttatttgtttgggaaagccaccctttctggcttccggaac
attcgttgttga

DBGET integrated database retrieval system