KEGG   Rattus norvegicus (rat): 25204Help
Entry
25204             CDS       T01003                                 

Gene name
Pcsk1, BDP, PC1, PC3
Definition
proprotein convertase subtilisin/kexin type 1 (EC:3.4.21.93)
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     25204 (Pcsk1)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S8: subtilisin family
   25204 (Pcsk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
2q11-q12
AA seq 752 aa AA seqDB search
MKQRGWTLQCTAFTLFCVWCALNSVKAKRQFVNEWAAEIHGGPEAASAIAEELGYDLLGQ
IGSLENHYLFKHKNHPRRSRRSALHITKRLSDDDRVIWAEQQYEKERRKRSVPRDSALNL
FNDPMWNQQWYLQDTRMTASLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPRTWRNVPEKKECIIKDNNFEPRALK
ANGEVIVEIPTRACEGQENAINSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPVGTWTLKVTDMSGRMQNEGRIVNWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKMVNVVEEKPTQNSLNGNLLVPKNSSSSSVEDRRDEQVQ
GAPSKAMLRLLQSAFSKNTPSKQSSKIPSAKLSVPYEGLYEALEKLNKPSQLEDSEDSLY
SDYVDVFYNTKPYKHRDDRLLQALMDILNEKN
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaagaggttggactctgcagtgtactgctttcaccctcttttgcgtttggtgt
gcactgaacagtgtaaaagcgaagaggcagtttgtcaatgaatgggcggcggagatacat
ggagggccagaagctgcttctgccattgccgaagagctgggctatgacctcttgggtcag
attggatcacttgaaaatcactatttattcaaacacaaaaatcatcctcgaagatcccga
agaagtgctcttcatatcactaagaggttatctgatgatgatcgtgtgatatgggcggaa
caacaatatgaaaaagagagaagaaaacgttcagttccaagagactcagcattgaatctc
ttcaatgatccaatgtggaatcagcagtggtacttgcaagacaccagaatgactgcatct
ctgcccaagctggacttgcatgtaatacctgtttggcaaaagggtattactggcaaagga
gttgttattactgtactggacgatggcttggagtggaatcacacagatatttatgccaat
tatgacccagaggctagctatgattttaatgataatgatcatgatccatttccccgatat
gatcccacaaatgaaaacaaacatggaacaagatgtgcaggagaaattgccatgcaagca
aataatcacaaatgtggagttggagttgcatataattccaaagttggaggcataagaatg
ctggatggcattgtaactgatgccattgaggctagttcaattggattcaaccctggccat
gtggatatttacagtgcaagctggggccctaatgatgatggaaaaactgtggaggggcct
ggcagactagcccagaaggcatttgaatacggtgtcaaacaggggagacaaggaaaaggc
tccatttttgtctgggcttcagggaatgggggtcgtcaaggagataactgtgactgtgat
ggctacacagacagcatttacaccatctctatcagcagtgcctcccagcagggcctgtca
ccctggtatgcagagaagtgttcctccacactggccacctcctacagcagtggtgattac
acagaccaacgaataactagtgcggacctgcacaatgactgcacagagacccacacaggc
acctcagcttctgcacctctggctgctggcatctttgctctagccttggaagcaaaccca
aatctcacctggcgagatatgcagcatctggttgtctggacctctgagtatgacccattg
gccaataacccaggttggaaaaagaatggagcgggcttgatggtgaacagccgatttgga
tttggcttgctaaatgccaaagctctggtggatttggctgatcctagaacttggagaaac
gtgcctgagaagaaagaatgtatcataaaagacaacaactttgagcctagagccctgaaa
gctaatggagaagtgattgttgaaatccctacaagagcttgtgaaggacaagaaaatgct
atcaattccctggaacatgtgcaatttgaagcaacaatcgaatattctcgtagaggagac
cttcatgtcacacttacctctgctgctggaaccagcaccgtactgttggctgaaagggaa
agggatacatcccccaatggctttaagaattgggacttcatgtctgttcatacatgggga
gagaatcctgtaggcacctggacattgaaagttacagacatgtctggaagaatgcaaaat
gaaggaaggattgtgaactggaagttgattttgcatggcacatcttctcagccagaacac
atgaagcagcctcgtgtatacacgtcctacaatactgtccagaatgacaggagaggagtg
gaaaagatggtgaatgttgtggaggagaagcccacacaaaacagcctgaatggcaatctc
ctggtacccaaaaactccagcagcagcagtgtggaagacagaagagatgagcaggtacaa
ggagctccttcaaaggccatgctacggctcctacaaagtgctttcagcaagaacacacct
tcaaagcaatcatcaaagattccaagtgctaagctcagtgtcccttatgagggtctctat
gaagccctggaaaagctcaacaagccctcccagcttgaagactctgaagacagtctgtat
agcgactatgttgatgttttctataacacaaaaccttataagcatagagatgacaggctg
ctgcaagcactcatggacattctgaatgagaagaattaa

DBGET integrated database retrieval system