KEGG   Rattus norvegicus (rat): 25211Help
Entry
25211             CDS       T01003                                 

Gene name
Lyz2, Lysz, Lyz, Lyz1
Definition
lysozyme 2 (EC:3.2.1.17)
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04970 Salivary secretion
    25211 (Lyz2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     25211 (Lyz2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25211 (Lyz2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q22
AA seq 148 aa AA seqDB search
MKALLVLGFLLLSASVQAKIYERCEFARTLKRNGMSGYYGVSLADWVCLAQHESNYNTQA
RNYNPGDQSTDYGIFQINSRYWCNDGKTPRAKNACGIPCSALLQDDITQAIQCAKRVVRD
PQGIRAWVAWQRHCKNRDLSGYIRNCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctctcctagttctggggttcctcctgctctctgcctctgtccaggccaagatc
tatgaacgctgtgagttcgccagaactctgaaaaggaatgggatgtctggctactatgga
gtcagcctggcagactgggtgtgtttagctcagcatgagagcaattataacacacaagcc
agaaactacaaccctggagaccaaagcaccgactatgggatatttcagatcaatagccga
tactggtgtaatgacggcaaaaccccaagagcaaagaacgcctgtgggataccctgcagc
gctctgctgcaggatgacatcactcaagccatacaatgtgcgaagagagttgtgagggat
ccccaaggcattcgagcatgggtggcatggcaaagacactgtaaaaaccgagatctatcc
gggtatattcggaactgcggagtctga

DBGET integrated database retrieval system