KEGG   Rattus norvegicus (rat): 25255Help
Entry
25255             CDS       T01003                                 

Gene name
Dyrk1a, Dyrk, PSK47
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A (EC:2.7.12.2)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     25255 (Dyrk1a)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   25255 (Dyrk1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
11q11
AA seq 763 aa AA seqDB search
MHTGGETSACKPSSVRLAPSFSFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIPPAHILDQAPKARKFFEKLPDGTWSLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFAAAVQAMDCETHSPQVRQQFPAPLGWSGTEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVAANTLDFGQNGAMDVNLTVYSNPRQETGIAGHPTY
QFSANTGPAHYMTEGHLTMRQGADREESPMTGVCVQQSPVASS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggaggagagacttcagcatgcaaaccttcatctgtccggctcgcaccgtca
ttctcattccatgctgctggccttcagatggctgcacagatgccccattcacatcagtac
agtgaccgtcgccagccaaacataagtgaccagcaggtttctgccttatcatattctgac
cagattcagcaacctctaactaaccaggtgatgcctgacattgtcatgttacagaggcgg
atgccccaaaccttccgtgatccagcaactgctcctctgagaaaactctctgtggacttg
atcaaaacatacaagcatattaatgaggtttactatgcaaaaaagaagcgaagacaccaa
cagggccagggggacgattctagtcataagaaggagcggaaggtttacaacgatggttac
gatgacgataactatgattacattgtaaaaaacggagaaaagtggatggaccgttatgaa
atcgactccttaataggcaaaggttcatttggacaggttgtgaaagcatatgacagagtg
gaacaagaatgggtcgccattaaaatcatcaagaacaagaaggcgtttctgaatcaagcg
cagatagaagtgcggctgcttgagctcatgaacaaacatgacactgagatgaagtactac
atagtgcatttgaaacgccactttatgtttcggaaccatctctgtctagtgtttgaaatg
ctgtcctataatctctatgatttgttgaggaacaccaacttccgaggggtctctttgaac
ctgacacgaaagtttgcacaacagatgtgcacagcattgcttttccttgcgactccagaa
cttagtatcattcactgtgacttaaagccggagaacatccttctgtgtaaccccaaacga
agtgcaatcaagattgttgactttggcagctcttgtcagttggggcagaggatataccag
tatattcagagtcgcttctatcggtctccagaggtgctactgggaatgccttatgacctt
gctatcgacatgtggtcccttggatgtatcttggttgaaatgcacactggagagcctctg
ttcagtggtgccaatgaggtggatcagatgaataaaatagtggaagtcttgggcatccca
cctgctcatattcttgaccaagcaccgaaagcaagaaagttctttgagaagttgcctgat
ggcacttggagcttaaagaagaccaaagatggaaaacgggagtacaaaccaccaggaacc
cgtaaacttcataatattcttggagtggaaacaggaggacctggcgggcggcgtgctggg
gagtcaggtcacactgtagctgactacttgaagttcaaagacctcattttaaggatgctt
gattatgaccccaaaactcggattcaaccttattatgccctgcagcacagttttttcaag
aaaacagctgatgaaggtacaaacacaagcaacagtgtgtccaccagccctgccatggag
cagtcccagtcttcaggcaccacctccagcacctcctccagctcaggtggatcctcggga
acgagcaacagtgggagagccaggtcggatccgacgcaccagcatcggcacagtggcggg
cacttcgctgctgctgtccaggccatggactgtgagacacatagtccccaggtgcgccag
cagtttccggctcctctgggctggtcaggcactgaagctcctacacaagtcactgttgaa
actcatcctgttcaagaaacaacctttcatgtagcccctcagcagaatgcattgcatcat
caccatggaaacagttcccatcatcaccaccaccaccatcaccaccaccaccaccatgga
cagcaagccttgggtaaccggaccaggccaagggtctacaattctccaacaaatagctcc
tctacccaggattctatggaggttggccacagtcaccactccatgacatccctgtcttcc
tcaacaacttcttcctcgacatcttcctcctctactggtaatcaaggcaatcaggcctat
cagaaccgcccagtggctgctaacaccttggactttggacagaatggagctatggacgtt
aatttgaccgtctactccaatccccgccaagagactggcatagctggacatccaacatac
caattttctgctaatacaggtcctgcacattacatgactgaaggacatctgacgatgagg
caaggggctgatagagaagagtctcccatgacaggagtttgtgtgcaacagagtcctgta
gctagctcgtga

DBGET integrated database retrieval system