KEGG   Rattus norvegicus (rat): 25257Help
Entry
25257             CDS       T01003                                 

Gene name
Gamt, GMT
Definition
guanidinoacetate N-methyltransferase (EC:2.1.1.2)
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    25257 (Gamt)
   00330 Arginine and proline metabolism
    25257 (Gamt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     25257 (Gamt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q11
AA seq 236 aa AA seqDB search
MSSSAASPLFAPGEDCGPAWRAAPAAYDTSDTHLQILGKPVMERWETPYMHSLAAAAASR
GGRVLEVGFGMAIAASRVQQAPIKEHWIIECNDGVFQRLQNWALKQPHKVVPLKGLWEEV
APTLPDGHFDGILYDTYPLSEETWHTHQFNFIKTHAFRLLKPGGILTYCNLTSWGELMKS
KYTDITAMFEETQVPALLEAGFQRENICTEVMALVPPADCRYYAFPQMITPLVTKH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttctgcagccagcccgcttttcgcgcctggcgaggactgcggccccgcgtgg
cgcgcggcccccgcggcctatgatacgtctgacacgcacctgcagatcctgggcaagcca
gtaatggagcgttgggagaccccctacatgcattcgctggcggctgctgctgcctccaga
gggggccgggtcctggaagtgggctttgggatggccattgcagcctccagggtgcagcag
gcccccataaaggaacactggattattgaatgcaacgatggggtcttccagcgtctacaa
aactgggccctgaagcagccacataaggttgttcccttgaaaggcctgtgggaggaggtg
gcacctacactgcctgatggtcactttgatgggattctatacgacacatatccactgtct
gaagagacctggcacactcaccagttcaactttattaagactcatgctttccgtttgctg
aagcctgggggtatcctcacttactgcaacctcacgtcctggggggaactcatgaagtcc
aagtacacagacatcactgccatgtttgaggagactcaggtgcctgcactgctggaagct
ggcttccagagagaaaacatctgtacagaggtgatggcgctggtgcccccagccgactgc
cgctactatgccttccctcagatgatcacacccctggtcaccaagcactga

DBGET integrated database retrieval system