KEGG   Rattus norvegicus (rat): 25267Help
Entry
25267             CDS       T01003                                 

Gene name
Pdgfra, APDGFR, PDGFACE
Definition
platelet derived growth factor receptor, alpha polypeptide (EC:2.7.10.1)
Orthology
K04363  
platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Cytokine-cytokine receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
HTLV-I infection
Pathways in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25267 (Pdgfra)
   04015 Rap1 signaling pathway
    25267 (Pdgfra)
   04010 MAPK signaling pathway
    25267 (Pdgfra)
   04020 Calcium signaling pathway
    25267 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    25267 (Pdgfra)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    25267 (Pdgfra)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    25267 (Pdgfra)
  Cell motility
   04810 Regulation of actin cytoskeleton
    25267 (Pdgfra)
  Cellular commiunity
   04510 Focal adhesion
    25267 (Pdgfra)
   04540 Gap junction
    25267 (Pdgfra)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25267 (Pdgfra)
   05206 MicroRNAs in cancer
    25267 (Pdgfra)
   05214 Glioma
    25267 (Pdgfra)
   05218 Melanoma
    25267 (Pdgfra)
   05215 Prostate cancer
    25267 (Pdgfra)
  Infectious diseases
   05166 HTLV-I infection
    25267 (Pdgfra)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     25267 (Pdgfra)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  PDGFR family [OT]
   25267 (Pdgfra)
Enzyme-linked receptors [BR:rno01020]
 Receptor tyrosine kinases
  RTK class III (PDGF receptor family)
   25267 (Pdgfra)
Cytokine receptors [BR:rno04050]
 Receptor tyrosine kinase
  RTK class III (PDGF receptor family)
   25267 (Pdgfra)
Cellular antigens [BR:rno04090]
 Proteins
  25267 (Pdgfra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p11
AA seq 1088 aa AA seqDB search
MGTSQAFLVLSCLLTGPSLIVCQLLLPSILPNENEKIVPLSSSFSLRCFGESEVSWQHPM
SEEEDPNVEIRTEENNSSLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIYV
PDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPDTEVTLHNNGRLVPASYDSRQGFNGT
FSVGPYICEATVRGRTFKTSEFNVYALKATSELNLEMDTRQTVYKAGETIVVTCAVFNNE
VVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVKE
MKTVTISVHEKGFVQIRPTFGHLETVNLHQVREFVVEVQAYPTPRISWLKDNLTLIENLT
EITTDVQRSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDMKSYTFELSTLVPASILELV
DDHHGSGGGQTVRCTAEGTPLPNIEWMICKDIKKCNNDTSWTVLASNVSNIITEFHQRGR
STVEGRVSFAKVEETIAVRCLAKNDLGIGNRELKLVAPTLRSELTVAAAVLVLLVIVIVS
LIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILGS
GAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLL
GACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSRHPEKPKKDLDIFGLNPADESTRSYV
ILSFENNGDYVDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEAKNL
LSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLAR
DIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGVLLWEIFSLGGTPYPGMMV
DSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKKS
YEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKEWEGGLDEQRLSADSGYIIP
LPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSS
DLVEDSFL
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atggggacctcccaggcctttctggtcctcagctgtctcctcacagggccgagcctcatc
gtctgccagctcttattaccctccatccttccaaatgagaatgagaagattgtgccgctg
agttcgtccttctctctgagatgcttcggggagagcgaagtgagctggcagcaccccatg
tctgaagaagaggaccccaacgtggaaatcagaaccgaggagaacaacagtagcctcttt
gtcacggtgctggaagtggtcaacgcctcagcggcccacaccggatggtacacttgctat
tacaaccacactcagacagaagagagtgagatcgaaggcaggcacatttatatctatgta
ccagacccagacatggccttcgtgcctctcggcatgacggattctttagtcattgtggaa
gaggacgattctgccatcataccctgccgcaccacggatccagacactgaagtaaccttg
cacaataacgggaggctggtgcctgcctcctacgacagcaggcagggcttcaacggaacc
ttcagtgtggggccttacatctgtgaggccaccgtcagagggaggacgttcaagaccagc
gagtttaacgtttatgccttgaaagccacgtcagaactgaatctggagatggacacacgc
cagactgtgtataaggcaggagaaacgatcgtggtgacctgcgccgtctttaacaatgag
gtggttgacctgcagtggacttaccctggagaggtgagaaacaaaggcatcaccatgctg
gaggagatcaaactcccgtccatcaaactggtgtacacgctgaccgtccccaaggccacg
gtgaaggacagtggagattatgaatgtgctgcccgccaggccacgaaagaggtcaaggaa
atgaagacagtcaccatttctgttcacgagaaaggcttcgtccagatcaggcccaccttt
ggccatctggaaactgtgaacctgcatcaggtcagagagttcgtggtggaggtgcaggcc
tacccgacccccaggatatcctggctgaaggacaacttgaccctgattgagaatctcact
gagatcaccaccgatgtgcagaggagccaggagacgaggtatcaaagcaaattaaagctg
atccgggctaaggaagaagacagcggccattataccattatagttcagaatgacgacgac
atgaagagctacacgtttgagctgtcaactctagttcctgcctccattctggagcttgtg
gatgaccaccatggctctggcgggggacagactgtgaggtgcacggctgaaggcacccct
cttccgaacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacacttca
tggacagttttggccagcaacgtctcgaatattatcacggagttccaccagcgaggcagg
agtacagtggagggacgagtgtccttcgccaaggtggaagagaccatcgcagttcggtgc
ttggcaaagaacgaccttggcattgggaacagagagctgaagctggtggctcccaccctg
cgatctgagctcacggtggcggccgcggtgctggtgctgttggtgattgtcattgtctct
ctcattgtcctggttgtcatttggaagcagaaaccacggtatgaaattcgatggagggtc
attgagtcaatcagccctgatggacatgagtatatttatgtggaccccatgcagctgcct
tacgactccagatgggagttcccgagagatggactagtgcttggtcggatcttgggatcc
ggtgcatttgggaaagtggttgaaggcacagcttatggattaagccggtcccagcctgta
atgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgagaagcaagctctc
atgtctgagctgaagataatgactcacttgggaccgcatctgaacattgtgaatttgctg
ggagcctgcaccaagtcaggccccatttacatcatcacagaatactgcttctatggggat
ttggtcaattacctgcataagaacagagatagcttcatgagccgacacccagagaagcca
aagaaagacctggacatctttggattgaatcctgcagatgagagtaccaggagttacgtg
attttatcttttgaaaacaatggtgactacgtggacatgaagcaggctgacaccacacag
tacgtgccaatgctggaaaggaaggaggtttccaaatactccgacatccagagatcgctg
tacgatcggccggcctcctataagaagaaatccatgctagactcagaagctaaaaacctc
ctttcggatgatgactccgagggtctgactttgctggacctactaagcttcacctaccaa
gtggcccgagggatggaatttttggcttcgaaaaattgtgtccaccgggacctggctgcc
cgcaacgtccttctggcgcaggggaaaatcgtgaagatctgtgacttcgggctggccaga
gacatcatgcacgattctaactacgtgtcaaagggcagcactttcctgcctgtgaagtgg
atggcacctgagagcatttttgacaacctctacaccacgctgagtgacgtctggtcttat
ggcgttctgctctgggaaatattctcccttggtggcacaccctaccctggcatgatggtt
gattctactttctacaataagatcaagagcggatacaggatggccaaacccgaccatgcc
accagtgaagtctatgagattatggtgcagtgctggaacagtgaacccgaaaagagaccc
tccttctaccacctcagcgagatagtggagaatctgctgcctggacagtacaaaaagagt
tatgaaaagattcacctggacttcctaaagagtgaccatccggctgtggcacgcatgcgt
gtggactctgacaacgcgtacatcggtgtcacttacaaaaatgaagaggacaagctgaag
gaatgggaaggtggcctggatgaacagagattgagcgcagatagtggctacatcattccc
ctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacacagc
tcgcagacttcggaagagagcgccatcgagacgggttccagtagttccactttcatcaag
agagaggacgagaccattgaggacatcgacatgatggatgatattggcatagattcctca
gacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system