KEGG   Rattus norvegicus (rat): 25271Help
Entry
25271             CDS       T01003                                 

Gene name
Rxra
Definition
(RefSeq) retinoid X receptor alpha
  KO
K08524  retinoid X receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03320  PPAR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04659  Th17 cell differentiation
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04976  Bile secretion
rno05160  Hepatitis C
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05216  Thyroid cancer
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    25271 (Rxra)
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    25271 (Rxra)
  Endocrine system
   04920 Adipocytokine signaling pathway
    25271 (Rxra)
   03320 PPAR signaling pathway
    25271 (Rxra)
   04919 Thyroid hormone signaling pathway
    25271 (Rxra)
   04928 Parathyroid hormone synthesis, secretion and action
    25271 (Rxra)
  Digestive system
   04976 Bile secretion
    25271 (Rxra)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25271 (Rxra)
   05202 Transcriptional misregulation in cancers
    25271 (Rxra)
   05226 Gastric cancer
    25271 (Rxra)
   05216 Thyroid cancer
    25271 (Rxra)
   05222 Small cell lung cancer
    25271 (Rxra)
   05223 Non-small cell lung cancer
    25271 (Rxra)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25271 (Rxra)
  Infectious diseases
   05160 Hepatitis C
    25271 (Rxra)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    25271 (Rxra)
Nuclear receptors [BR:rno03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   25271 (Rxra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 25271
NCBI-ProteinID: NP_036937
RGD: 3610
Ensembl: ENSRNOG00000009446
UniProt: Q0VJ96
Position
3p12
AA seq 467 aa AA seqDB search
MDTKHFLPLDFSTQVNSSSLSSPTGRGSMAAPSLHPSLGPGLGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGNMSSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQTT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctctacccaggtgaactcttcatccctg
agctctccaacgggtcgaggctccatggctgccccctcgctgcacccttccctgggtcca
ggactcggctctcctctgggctcccctgggcagctgcactcgcctatcagcaccctgagt
tctcccatcaatggcatgggcccacccttctcggtcatcagctccccgatgggcccgcac
tccatgtcggtacccaccacacccacactgggcttcgggactggcagcccccagctcaac
tcacccatgaaccccgtgagcagcagtgaggatatcaaaccccctctaggcctcaatggc
gtcctcaaggttcctgcccacccctcaggaaatatgtcatccttcaccaagcacatctgc
gctatctgtggggaccgctcctcaggcaaacactatggggtctacagctgtgagggctgc
aagggcttcttcaagaggacagtacgcaaagacctgacctacacctgccgtgacaacaag
gactgcctgatcgacaagagacagcggaaccggtgtcagtactgccgataccagaagtgc
ctggccatgggcatgaagcgggaagccgtgcaggaggagcggcagcgaggcaaggaccgg
aacgagaatgaggtggagtccaccagcagtgccaacgaggacatgcctgtagagaagatt
ctggaagctgagctcgctgttgagcccaagactgagacatacgtggaggcaaacatgggg
ctgaaccccagctcaccaaatgaccctgttaccaacatctgtcaagcagcagacaagcag
ctcttcactcttgtggagtgggccaagaggatcccacacttttctgagctgcccctggac
gaccaggtcatcctcctccgggcaggctggaacgagctgctgattgcctccttctcccac
cgctccatagctgtgaaagacggcatcctcctggccaccggcctgcacgtacacaggaac
agcgctcacagtgctggggtgggcgccatctttgacagggtgctaacggagctggtgtcg
aagatgcgtgacatgcagatggacaagacggagctgggctgcttgcgcgccattgtcctc
ttcaaccctgactctaaggggctctcaaaccctgctgaggtggaggcgctgagggagaag
gtgtatgcatcactagaagcgtactgcaaacacaagtaccctgagcagccgggcaggttt
gccaagctgctgctccggctgcctgcactgcgatccattgggctcaagtgcctggagcac
ctgttcttcttcaagctcatcggggatacacccatcgacactttcctcatggagatgctg
gaggccccacatcaaaccacctag

DBGET integrated database retrieval system