KEGG   Rattus norvegicus (rat): 25271Help
Entry
25271             CDS       T01003                                 

Gene name
Rxra
Definition
retinoid X receptor alpha
Orthology
K08524  
retinoid X receptor alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
PPAR signaling pathway
PI3K-Akt signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Bile secretion
Hepatitis C
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:rno04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:rno03320]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:rno04919]
Organismal Systems; Digestive system; Bile secretion [PATH:rno04976]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:rno05202]
Human Diseases; Cancers; Thyroid cancer [PATH:rno05216]
Human Diseases; Cancers; Small cell lung cancer [PATH:rno05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:rno05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:rno04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:rno05160]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3p12
AA seq 467 aa AA seqDB search
MDTKHFLPLDFSTQVNSSSLSSPTGRGSMAAPSLHPSLGPGLGSPLGSPGQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSSEDIKPPLGLNG
VLKVPAHPSGNMSSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQTT
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctcgacttctctacccaggtgaactcttcatccctg
agctctccaacgggtcgaggctccatggctgccccctcgctgcacccttccctgggtcca
ggactcggctctcctctgggctcccctgggcagctgcactcgcctatcagcaccctgagt
tctcccatcaatggcatgggcccacccttctcggtcatcagctccccgatgggcccgcac
tccatgtcggtacccaccacacccacactgggcttcgggactggcagcccccagctcaac
tcacccatgaaccccgtgagcagcagtgaggatatcaaaccccctctaggcctcaatggc
gtcctcaaggttcctgcccacccctcaggaaatatgtcatccttcaccaagcacatctgc
gctatctgtggggaccgctcctcaggcaaacactatggggtctacagctgtgagggctgc
aagggcttcttcaagaggacagtacgcaaagacctgacctacacctgccgtgacaacaag
gactgcctgatcgacaagagacagcggaaccggtgtcagtactgccgataccagaagtgc
ctggccatgggcatgaagcgggaagccgtgcaggaggagcggcagcgaggcaaggaccgg
aacgagaatgaggtggagtccaccagcagtgccaacgaggacatgcctgtagagaagatt
ctggaagctgagctcgctgttgagcccaagactgagacatacgtggaggcaaacatgggg
ctgaaccccagctcaccaaatgaccctgttaccaacatctgtcaagcagcagacaagcag
ctcttcactcttgtggagtgggccaagaggatcccacacttttctgagctgcccctggac
gaccaggtcatcctcctccgggcaggctggaacgagctgctgattgcctccttctcccac
cgctccatagctgtgaaagacggcatcctcctggccaccggcctgcacgtacacaggaac
agcgctcacagtgctggggtgggcgccatctttgacagggtgctaacggagctggtgtcg
aagatgcgtgacatgcagatggacaagacggagctgggctgcttgcgcgccattgtcctc
ttcaaccctgactctaaggggctctcaaaccctgctgaggtggaggcgctgagggagaag
gtgtatgcatcactagaagcgtactgcaaacacaagtaccctgagcagccgggcaggttt
gccaagctgctgctccggctgcctgcactgcgatccattgggctcaagtgcctggagcac
ctgttcttcttcaagctcatcggggatacacccatcgacactttcctcatggagatgctg
gaggccccacatcaaaccacctag

DBGET integrated database retrieval system