KEGG   Rattus norvegicus (rat): 252879Help
Entry
252879            CDS       T01003                                 

Gene name
Cdk11b, Cdc2l1, Cdk11
Definition
(RefSeq) cyclin-dependent kinase 11B (EC:2.7.11.22)
  KO
K08818  
cell division cycle 2-like [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     252879 (Cdk11b)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   252879 (Cdk11b)
Spliceosome [BR:rno03041]
 Complex A
  Other components
   Complex A specific factors
    252879 (Cdk11b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 784 aa AA seqDB search
MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEI
TIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGK
HARVKEKEREHERRKRHREEQDKARREWERQKRREMAREHSRRERDRLEQLERKRERERK
MREQQKEQREQKERERRAEERRKEREARREVSAHHRTMREDYSDKGKVGHWSRSPLRPPR
ERFELGDNRKPVREEKVEERDLLSDLQDISDSERKTSSAESSSAESGSGSEEEEEEEEEE
EEEEGSTSEESEEEEEEEEEEEEEETGSNSEEASEQSAEEVSDEEMSEDEDRENENHILV
VPESRFDRDSGDSDEGEEEVGEGTPQSSAPTEGDYVPDSPALSPIELKQELPKYLPALQG
CRSVEEFQCLNRIEEGTYGVVYRAKDKKTDEIVALKRLKMEKEKEGFPITSLREINTILK
AQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLSGVK
HLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLKAYTPVVVTLWYRAPELLLG
AKEYSTAVDMWSVGCIFGELLTQKPLFPGKSEIDQINKVFKDLGTPSEKIWPGYNDLPAV
KKMTFSEYPYNNLRKRFGALLSDQGFDLMNKFLTYFPGRRVSAEDGLKHEYFRETPLPID
SSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGF
SLKF
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgaaaaggactcttggaaagtgaaaacgttagatgaaattctccaggaaaag
aaacgaaggaaagaacaagaggagaaagcagagataaaacgcttaaaaaattctgatgac
cgggattccaaaagggattcccttgaggagggggagctgagagatcatcgaatggaaatc
acaatcaggaactcaccatacagaagagaggattctatggaagacagaggagaggaggat
gattctctggccatcaaaccaccccagcaaatgtctcgaaaagaaaaggctcatcacaga
aaagatgagaaaagaaaagagaagcgtcgacatcgtagtcactcagcagagggagggaaa
catgcccgagtaaaagagaaagaaagagaacacgagcggcggaaacggcatcgagaggaa
caggataaagcacgaagagaatgggaaagacagaagaggagggagatggcaagagagcat
tccaggagagagagggaccgcctggagcagttagaaaggaagagggagcgggagcgcaag
atgagggagcaacagaaggaacagcgggaacaaaaggaacgggaacggagggcagaggag
cgccgcaaagagagagaagctcgtagggaagtctctgcacatcaccgtaccatgagggag
gactacagtgataagggaaaggttggccactggagccgcagccctttgaggccaccaaga
gagcgctttgagctgggagacaaccggaagccagtgagagaagagaaggtggaagaaaga
gacctgctgtcggacctccaggacatcagtgacagtgagaggaagaccagctcagctgag
tcctcatcagcagaatcaggctcaggttctgaggaggaggaggaggaggaggaggaagaa
gaggaggaggaagggagcaccagtgaagagtcagaggaagaggaagaagaggaagaggag
gaagaggaggaggaaactgggagcaactctgaggaagcctcagaacagtctgctgaagaa
gtcagtgacgaagaaatgagtgaagatgaagacagagaaaatgagaaccacatcttggtt
gttccagagtcgcgatttgaccgagattctggggacagtgatgaaggagaagaagaagtt
ggtgaggggacaccgcagagcagcgcccctaccgagggagactatgtgcccgactctcca
gctctgtcacctattgagctaaaacaagagctgcccaagtacctgccagccctgcaggga
tgccggagtgtagaggagtttcagtgtctgaacaggattgaagaaggcacctatggggtg
gtctacagagcaaaggacaagaaaacagatgagattgtggctctgaagcggttaaagatg
gagaaggagaaggaaggcttcccaatcacatcactgagggaaatcaacaccatcctcaag
gcccagcaccccaatatcgtcactgtcagagaaattgttgtgggaagcaacatggacaag
atctacattgtgatgaactatgtggaacacgacctcaagagcctaatggagacaatgaaa
cagcccttcctgccaggggaggtgaagaccctgatgattcagctgttgagtggggtgaag
cacctccatgacaattggatcctacatcgtgaccttaagacctctaaccttctgctgagc
catgctggcattctcaaggtgggcgactttgggctggctcgggagtatggttcaccccta
aaggcctacactccagttgttgtaaccctgtggtatcgtgccccagaactgctccttggt
gctaaggaatactccacagctgtggacatgtggtcagtgggctgcatatttggagaactg
ctgacacagaaacctctgttccctgggaagtcagagattgatcagattaacaaggttttc
aaggacctggggacccccagtgagaaaatctggcctggctataatgacctcccagccgtc
aagaagatgaccttcagcgagtatccctataacaacctccgcaagcgattcggagctttg
ttatcagatcaaggattcgatctcatgaacaagtttctgacttacttccctgggaggagg
gtcagcgcagaagatggcctcaagcacgagtatttccgagagactcccctccccatcgac
tcatccatgttccccacgtggcctgccaagagtgagcagcagagggtgaagagaggcacg
agtccgaggccccctgagggcggcctgggctacagccagctgggagacgacgacctgaag
gagacgggcttccacctcaccaccaccaaccagggagcctcagctgctggccctggcttc
agcctcaagttctga

DBGET integrated database retrieval system