KEGG   Rattus norvegicus (rat): 25289Help
Entry
25289             CDS       T01003                                 

Gene name
Adcy6, ACVI, ADCYB
Definition
adenylate cyclase 6 (EC:4.6.1.1)
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Purine metabolism
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
GABAergic synapse
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Bile secretion
Morphine addiction
HTLV-I infection
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    25289 (Adcy6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    25289 (Adcy6)
   04024 cAMP signaling pathway
    25289 (Adcy6)
   04022 cGMP - PKG signaling pathway
    25289 (Adcy6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    25289 (Adcy6)
  Cellular commiunity
   04540 Gap junction
    25289 (Adcy6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    25289 (Adcy6)
   04062 Chemokine signaling pathway
    25289 (Adcy6)
  Endocrine system
   04911 Insulin secretion
    25289 (Adcy6)
   04912 GnRH signaling pathway
    25289 (Adcy6)
   04913 Ovarian Steroidogenesis
    25289 (Adcy6)
   04915 Estrogen signaling pathway
    25289 (Adcy6)
   04914 Progesterone-mediated oocyte maturation
    25289 (Adcy6)
   04921 Oxytocin signaling pathway
    25289 (Adcy6)
   04918 Thyroid hormone synthesis
    25289 (Adcy6)
   04916 Melanogenesis
    25289 (Adcy6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25289 (Adcy6)
   04270 Vascular smooth muscle contraction
    25289 (Adcy6)
  Digestive system
   04970 Salivary secretion
    25289 (Adcy6)
   04971 Gastric acid secretion
    25289 (Adcy6)
   04972 Pancreatic secretion
    25289 (Adcy6)
   04976 Bile secretion
    25289 (Adcy6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    25289 (Adcy6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25289 (Adcy6)
  Nervous system
   04724 Glutamatergic synapse
    25289 (Adcy6)
   04727 GABAergic synapse
    25289 (Adcy6)
   04725 Cholinergic synapse
    25289 (Adcy6)
   04723 Retrograde endocannabinoid signaling
    25289 (Adcy6)
  Sensory system
   04742 Taste transduction
    25289 (Adcy6)
   04750 Inflammatory mediator regulation of TRP channels
    25289 (Adcy6)
  Environmental adaptation
   04713 Circadian entrainment
    25289 (Adcy6)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    25289 (Adcy6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    25289 (Adcy6)
  Infectious diseases
   05166 HTLV-I infection
    25289 (Adcy6)
Enzymes [BR:rno01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     25289 (Adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
X
AA seq 1180 aa AA seqDB search
MPLPVARSGSGRSSMSWFSGLLVPKVDERKTAWGERNGQKRPRQATRARGFCAPRYMSCL
KNVEPPSPTPAARTRCPWQDEAFIRRAGPGRGVELGLRSVALGFDDTEVTTPMGTAEVAP
DTSPRSGPSCWHRLAQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLT
FHAAPALPQPAYVALLTCASVLFVVLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGAL
AANPRSPSAGLWCPVFFVYITYTLLPIRMRAAVLSGLGLSTLHLILAWHLNNGDPFLWKQ
LGANVVLFLCTNAIGVCTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQ
HVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELF
ARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVN
VNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDY
EVEPGRGGERNAYLKEQCIETFLILGASQKRKEEKAMLVKLQRTRANSMEGLMPRWVPDR
AFSRTKDSKAFRQMGIDDSSKENRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRF
LLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQFLVFPHSALILGIYAGIFLLL
LVTVLICAVCSCGSFFPNALQRLSRSIVRSRVHSTAVGVFSVLLVFISAIANMFTCSHTP
LRTCAARMLNLTPSDVTACHLRQLNYSLGLEAPLCEGTAPTCSFPEYFVGSVLLSLLASS
VFLHISSIGKLVMTFVLGFIYLLLLLLGPPATIFDNYDLLLSVHGLASSNETFDGLDCPA
VGRVALKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLL
HNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLL
NEIIADFDEIISEERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLME
QMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQV
TTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgtggcccgatccggttctgggcgcagcagcatgtcatggtttagcggc
ctcctggttcccaaagtggatgaacggaaaacagcctggggcgaacgcaatggacagaag
cgcccacgccaggcgacccgagcccgtggcttctgcgcgccccgctacatgagctgcctc
aagaatgtggagccacccagccccactcctgcagctcgcactcggtgcccctggcaggat
gaagccttcatcaggagggctggcccgggaaggggtgtggagctggggctgcggtcagtg
gccttgggttttgatgacactgaggtgaccacaccgatggggacagctgaagtggcaccc
gacacatcgcctcgaagcggtccgtcctgctggcaccggctagcgcaggtgttccagtct
aagcagttccgctccgccaagctggagcgtctgtaccagcggtacttcttccagatgaac
cagagcagcctcacgctgctcatggcggtgcttgtgctcctcatggctgtactgttgacc
ttccacgccgcgcctgccctgcctcagcctgcttatgtggccctgctgacctgtgcctcc
gtcctttttgtggtactcatggtagtgtgtaaccgacatagcttccgccaggactccatg
tgggtagtgagctatgtggttctgggcatcctagcagccgtgcaagtcgggggtgccctg
gcagccaacccacgcagcccctcagcaggcctttggtgccccgtgttcttcgtctacatc
acctacacacttcttcccattcgtatgcgagcggccgtgctcagtggcctgggtctttcc
accctgcatttgattttggcctggcatctcaacaatggtgaccccttcctttggaagcag
ctcggtgctaacgtggtgctcttcctgtgcaccaatgccatcggtgtctgcacgcactac
cccgctgaagtgtctcagcgccaagcctttcaggagacccgtggttacatccaggcccgg
ctgcacttgcagcatgagaatcgacagcaggaacggctgctgctgtcggtgttgccccag
catgttgccatggaaatgaaagaggatatcaacacaaaaaaggaagacatgatgttccac
aagatttacatccagaagcatgacaatgtcagcatcctgtttgccgacatcgagggcttc
accagcctggcctcccagtgcactgcccaggaactggtcatgaccttgaatgagctcttt
gcccggttcgacaagctggctgcggagaatcactgtctgaggatcaagatcttaggagac
tgttactactgtgtgtcggggctgccggaggcccgggcagaccatgcccactgctgtgtg
gagatgggggtagacatgatcgaggccatctcgctggtgcgtgaggtaacgggtgtaaat
gtgaacatgcgcgtgggcatccacagcgggcgtgtacactgcggtgtccttggtctgcgg
aaatggcagtttgatgtctggtccaacgatgtgaccctggccaaccacatggaggcgggg
ggccgggccggccgcatccacatcactcgggccacactgcagtacctgaacggggactat
gaggtggagccaggccgtggcggtgagcgcaacgcgtacctcaaggagcagtgcattgag
accttcctcatactaggagccagccagaaacggaaagaggagaaggccatgctggtcaag
ctgcagcggacgcgggccaactccatggaaggactgatgccccgctgggttcctgaccgt
gccttctcccggaccaaggactctaaggcattccgacagatgggcatcgatgactctagc
aaagagaaccggggtgcccaagatgctctgaaccctgaggatgaggtggacgagtttctg
ggccgagccatcgatgcccgaagcatcgaccagctgcgtaaggaccatgtgcgccggttc
ctgctcaccttccagagggaggatctcgagaagaagtattcacggaaagtagaccctcgt
ttcggagcctacgtcgcctgtgccctcctggttttctgcttcatctgtttcatccagttc
ctcgtattcccacactccgccctgatactcgggatttatgccgggatcttccttttgctg
ctggtcaccgtgctcatctgtgctgtgtgctcctgtgggtctttcttccccaacgccctg
cagcgcctgtcccgcagtatcgtccgctcacgggtgcacagcacggctgttggagtcttc
tcggttctgcttgtgttcatctctgccattgccaacatgttcacctgcagtcacacccca
ctgaggacctgtgcggcccggatgctgaacttaacaccgtccgatgtcaccgcctgccac
ctacgacagctcaattactctctgggactggaagctcccctgtgtgagggcaccgcaccc
acctgcagcttccctgagtactttgtcgggagtgtgctgctgagtctcttggccagctcc
gtcttcctccacatcagcagcattggcaagctagttatgacctttgtcttggggttcatc
tacttgcttctgcttttgctgggtcccccagccaccatctttgacaactatgatctactg
cttagcgtccatggcttggcttcctccaatgagaccttcgatgggctggactgcccagcc
gtagggagggtagcgctcaaatacatgacccctgtgattctcctcgtgttcgccctggca
ctgtatctacacgcacaacaggtggaatctaccgcccgcctggacttcctgtggaaactg
caggccacaggggagaaggaggagatggaggagttgcaggcctacaaccggcggctgctg
cataacatccttcccaaggacgtggctgcccacttcctggcccgggagcgccgcaacgac
gagctgtactaccaatcctgcgagtgcgtggctgtcatgtttgcctccatcgccaacttc
tctgagttctatgtggaactggaggcgaacaatgagggcgtggagtgcctgcgactgctc
aatgagatcatcgcggactttgatgagatcatcagtgaggagaggttccggcagctggag
aagatcaagaccatcggtagcacttacatggccgcctccgggctaaatgccagcacctat
gaccaggtcggccgctcgcacatcaccgccctggcagactacgccatgcggcttatggag
caaatgaaacacatcaacgaacactctttcaacaacttccagatgaagatcgggttgaac
atgggtccggttgtagcaggtgtcattggggcccggaagccacagtatgacatctgggga
aacacggtgaatgtttccagccgtatggacagcacaggagttcctgaccgaatacaggtg
accacggatctgtaccaggttctagctgccaagggctaccaactggagtgtcgaggggtg
gtcaaggtgaagggaaagggggagatgaccacctacttcctcaatgggggccccagcagt
tag

DBGET integrated database retrieval system