KEGG   Rattus norvegicus (rat): 252931Help
Entry
252931            CDS       T01003                                 

Gene name
Cyp3a18
Definition
cytochrome P450, family 3, subfamily a, polypeptide 18 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    252931 (Cyp3a18)
   00591 Linoleic acid metabolism
    252931 (Cyp3a18)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    252931 (Cyp3a18)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    252931 (Cyp3a18)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     252931 (Cyp3a18)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP3 family
   252931 (Cyp3a18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12p11
AA seq 497 aa AA seqDB search
MEIIPNLSIETWVLLATSLMLFYIYGTYSHGLFKKLGIPGPKPVPLFGTIFNYGDGMWKF
DDDCYKKYGKIWGFYEGPQPFLAIMDPEIIKMVLVKECYSVFTNRRCFGPMGFMKKAITM
SEDEEWKRLRTILSPTFTSGKLKEMFPLMRQYGDTLLKNLRREEAKGEPINMKDIFGAYS
MDVITGTSFGVNVDSLNNPQDPFVQKAKKILKFQIFDPFLLSVVLFPFLTPIYEMLNFSI
FPRQSMNFFKKFVKTMKKNRLDSNQKNRVDFLQLMMNTQNSKGQESQKALSDLEMAAQAI
IFIFGGYDATSTSISFIMYELATRPNVQKKLQNEIDRALPNKAPVTYDALMEMEYLDMVV
NESLRLYPIATRLDRVSKKDVEINGVFIPKGTVVTIPIYPLHRNPEYWLEPEEFNPERFS
KENKGSIDPYVYLPFGNGPRNCIGMRFALISMKLAVIGVLQNFNIQPCEKTQIPLKISRQ
PIFQPEGPIILKLVSRD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggagatcattcccaacctttctatagagacctgggtgcttctagctactagcttgatg
ctcttctacatatatgggacctattctcatggcctgtttaagaaactaggaattcctgga
cccaaacctgtgcctttatttggcaccattttcaactacggtgatggcatgtggaaattt
gatgatgactgctataaaaagtatggaaaaatatgggggttttatgagggcccacagcct
tttttggctatcatggatccagagatcatcaaaatggtgctggtgaaagaatgttactca
gtcttcacaaaccgtcggtgttttgggccaatgggatttatgaaaaaggccattaccatg
tctgaggatgaagaatggaagagacttcgaacaatcctgtctccaaccttcaccagtggc
aaactcaaggagatgttccccctcatgagacagtatggagatacattgttgaagaacttg
aggcgagaagaagcaaaaggggagcccatcaacatgaaagacatctttggagcttatagc
atggacgtgatcactggcacatcatttggagtgaacgtcgattccctcaacaatccacag
gatcccttcgtgcagaaagccaagaagatcttaaaatttcaaatttttgatccatttctt
ctctctgtagttctgtttccatttcttactccaatatatgagatgttaaatttttcaatt
tttccaagacagtcaatgaactttttcaaaaaattcgtaaaaacaatgaagaaaaatcgc
cttgattcaaaccagaagaaccgagtggattttcttcaactgatgatgaatactcagaac
tccaaaggccaagagtcccagaaagctctttctgatctagaaatggcagcacaagctatt
attttcatttttgggggttatgatgccacaagcacctccatttccttcataatgtatgaa
ctggccactcgccccaatgtgcaaaagaaactccagaatgagattgatagagctctgccc
aataaggcacctgtcacctatgatgctctgatggaaatggagtacctggacatggtggtg
aatgaaagtctaagattgtacccaattgctaccaggctagacagagtctcaaaaaaggat
gtggaaatcaatggagtttttattcccaaagggactgtagttacgataccaatctatcct
cttcatcggaaccctgagtactggctagagcctgaggaattcaaccctgaaaggttcagc
aaggagaacaagggcagcattgatccttatgtatatctgccctttggaaatggacccagg
aactgcattggcatgaggtttgctctcatcagcatgaaacttgctgtcataggagtcctg
cagaacttcaatatccagccttgtgagaagacacagatccctctgaagatcagtaggcaa
ccaattttccaaccagaaggacccatcatcctaaagcttgtgtcaagagattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system