KEGG   Rattus norvegicus (rat): 25304Help
Entry
25304             CDS       T01003                                 

Gene name
Comp
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    25304 (Comp)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    25304 (Comp)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    25304 (Comp)
  Cellular commiunity
   04510 Focal adhesion
    25304 (Comp)
 Human Diseases
  Infectious diseases
   05144 Malaria
    25304 (Comp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25304 (Comp)
  Exosomal proteins of colorectal cancer cells
   25304 (Comp)
  Exosomal proteins of bladder cancer cells
   25304 (Comp)
Heparan sulfate/heparin binding proteins [BR:rno00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  25304 (Comp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
16
AA seq 755 aa AA seqDB search
MSPTACVLVLALAALRATGQGQIPLGGDLAPQMLRELQETNAALQDVRELLRHRVKEITF
LKNTVMECDACGMQPARTPGLSVRPVALCAPGSCFPGVVCTETATGARCGPCPPGYTGNG
SHCTDVNECNAHPCFPRVRCINTSPGFHCEACPPGFSGPTHEGVGLTFAKTNKQVCTDIN
ECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQRSGCQRRGQHFCPDGSPSPCHEKAD
CILERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQED
VDRDRIGDACDPDADGDGVPNEQDNCPLVRNPDQRNSDKDKWGDACDNCRSQKNDDQKDT
DRDGQGDACDDDIDGDRIRNVADNCPRVPNFDQSDSDGDGVGDACDNCPQKDNPDQRDVD
HDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGKGDACDDDDDNDGVPDSRD
NCRLVPNPGQEDNDRDGVGDACQGDFDADKVIDKIDVCPENAEVTLTDFRAFQTVVLDPE
GDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTATDDDYAGFIFG
YQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTAS
QVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTAMRGGRL
GVFCFSQENIIWANLRYRCNDTIPEDYERHRLRRA
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgagccccactgcctgcgttctagtgctcgccctggctgccttgcgggctaccggccag
ggccagatcccgctgggtggagacctagccccacagatgcttcgagaactccaggagact
aatgcggcgctgcaagacgtgagagagctcttgcgacacagggtcaaggagatcaccttc
ctgaagaatacggtgatggaatgtgacgcttgcggaatgcagcccgcacgcacccccggt
ctgagcgtgcggccagtcgcgctctgcgcacccggctcctgcttccctggcgtagtctgc
acggagacagctaccggcgcgcgctgcggcccctgccctccgggctacaccggcaacggc
tcgcactgcaccgacgttaatgagtgcaacgctcacccctgtttcccgcgcgtgcggtgc
atcaataccagccctggctttcactgcgaagcctgtccccctgggttcagcgggcccacc
cacgagggtgtggggctgaccttcgccaagaccaacaaacaagtttgcacagatattaat
gagtgtgagaccgggcagcacaattgcgttcccaactccgtgtgcgtcaacacccggggc
tccttccagtgcggtccctgccagcccggcttcgtgggcgaccagaggtcaggctgccag
cggcgtgggcaacacttctgccccgacgggtcacccagcccgtgccatgagaaagcagac
tgtattttggagcgcgacggctcaaggtcctgcgtgtgtgcggtcggctgggccggcaac
gggctcctgtgcggacgcgacacagacctggacggtttcccggacgagaagcttcgctgc
tcagagcgccagtgccgcaaggacaactgcgtgacggtgcccaattcagggcaggaggat
gtggaccgggaccgcattggagatgcttgtgacccggatgcggacggggatggagtccct
aatgagcaagacaattgcccgctggttcgaaacccagaccagcgcaactccgataaagac
aagtggggagatgcctgcgacaactgccggtcccagaagaatgatgaccagaaagataca
gaccgggatggccagggcgatgcctgcgacgacgacatagatggcgatcgaatccgaaat
gtagctgacaactgtccccgggtgcccaactttgaccagagtgacagcgatggtgatggt
gttggggatgcctgtgacaattgtccccagaaagacaacccggaccagagggacgtggac
cacgactttgtgggtgatgcctgtgacagtgaccaagaccaggacggggatggacaccaa
gactcccgggacaactgccccacagtgcccaacagtgcccagcaggactcagaccatgat
ggcaagggtgatgcctgtgatgatgacgacgacaatgacggagtccctgacagccgggac
aattgccgcttggtgcccaacccgggccaagaggacaatgaccgggatggcgtgggtgac
gcttgtcagggtgacttcgatgctgacaaggttatagacaagatcgatgtgtgccccgag
aacgccgaggtcactctcaccgacttcagggccttccaaacagttgtgctggaccccgag
ggtgatgcgcagatcgaccccaactgggtggtgctcaatcagggaatggagatcgttcag
accatgaacagtgaccctggcctggctgtgggttacacggcattcaacggtgtagatttt
gagggaacgttccatgtaaacaccgccaccgatgatgactacgctggcttcatcttcggc
tatcaagacagctcaagtttctatgtggtcatgtggaaacagatggagcagacgtactgg
caggccaatcctttccgggcagtggctgaaccagggattcagctcaaggctgtcaagtcc
tctacaggtcccggggaacagctccgaaatgcgttgtggcacacgggggacacagcatcc
caggtgcggctgctgtggaaggatcctcgaaatgtgggctggaaggataagacatcctac
cgctggttcctgcagcaccggcctcaagtcggctacatcagggtgcggttctatgagggt
cctgagctagtagctgacagcaacgtggtgctggacacagctatgcgtggtggccgcctg
ggtgtcttctgcttctcccaagagaatatcatctgggctaacctgcgctaccgttgcaat
gatacaatccctgaggactatgagcgtcaccggctgcggagggcctag

DBGET integrated database retrieval system