KEGG   Rattus norvegicus (rat): 25372Help
Entry
25372             CDS       T01003                                 

Gene name
Grk3, Adrbk2
Definition
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  
beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Chemokine signaling pathway
Endocytosis
Hedgehog signaling pathway
Glutamatergic synapse
Olfactory transduction
Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    25372 (Grk3)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    25372 (Grk3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    25372 (Grk3)
  Nervous system
   04724 Glutamatergic synapse
    25372 (Grk3)
  Sensory system
   04740 Olfactory transduction
    25372 (Grk3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    25372 (Grk3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     25372 (Grk3)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   25372 (Grk3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   25372 (Grk3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q16
AA seq 688 aa AA seqDB search
MADLEAVLADVSYLMAMEKSKATPAARASKKVVLPEPSIRSVMQRYLAERNEITFDKIFN
QKIGFLLFKDFCLNEIGEAVPQVKFYEEIKEYEKLDNEEDRLHRSRQMYDAYIMRELLSS
THQFSKQAVEHVQSHLSKKQVTPTLFQPYIEEICESLRGDIFQKFMESEKFTRFCQWKNV
ELNIHLSMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRVKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDMHYHLSQHGVFSEKEMRFYASE
IILGLEHMHTCFVVYRDLKPANILLDEYGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTCYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVQLPDAFSPE
LRSLLEGLLQRDVSQRLGCYGGGARELKEHIFFKGIDWQYVYLRKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQDLYKNFPLMISERWQQEVVETIYDAVNAETDKIEARK
KAKNKQLCQEEDYAMGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGESRQNL
LTMEQIMSVEETQIKDRKCILLRVKGGKQFVLQCESDPEFAQWLKELTCTFNEAQRLLRR
APKFLNKPRAAILEFSKPPLCHRNSSGL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgacgtcagctacctgatggccatggagaagagc
aaggcgacgccggccgcgcgcgccagcaagaaggtcgtcctgccggagcccagtatccgg
agtgtgatgcagaggtatctggcagaaagaaacgaaataacctttgacaagattttcaat
cagaaaatcggcttcctgctatttaaagatttctgcttgaatgaaatcggtgaagcggtg
cctcaggtgaaattttatgaagagataaaggaatacgagaaactggacaacgaagaagac
cggctgcaccggagtcggcagatgtacgacgcctacatcatgagggagcttctgtccagc
acacaccaattctcaaagcaagctgtagaacatgtccagagccatctctccaagaagcag
gtgacgcctaccctttttcagccgtacatagaagaaatctgcgaaagccttcgaggcgac
atcttccaaaagtttatggaaagcgaaaaattcactagattctgtcagtggaagaatgtg
gaattgaatattcatctgagcatgaacgacttcagtgtgcacaggatcatcggccgagga
gggtttggggaagtttacggctgcaggaaagcagacaccgggaaaatgtatgccatgaag
tgcttagacaagaagagagtgaagatgaaacagggagagacactggctttgaacgagagg
atcatgttgtctctcgtcagcactggggactgtcccttcattgtctgcatgacctatgcc
ttccacacaccagacaaactctgcttcatcctggacctgatgaacgggggcgacatgcac
taccacctctcccagcacggggtgttctctgagaaggagatgcgattttatgccagcgag
atcatcctgggcctcgagcacatgcacacctgctttgtagtctacagagacctgaagcct
gcgaacatcctcctggatgaatatgggcatgtgaggatatcggatcttggcctggcctgc
gatttctctaaaaagaagcctcacgccagtgtgggcacccatgggtacatggctcccgag
gtgttgcagaaggggacatgctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctcctgcggggccacagccctttcaggcagcataaaaccaaagacaagcat
gagatagaccgcatgaccctgaccgtgaacgtgcagcttccagatgccttctcccctgag
ctgaggtccctcttggagggtttgctccagcgggatgtgagccagcgactgggctgctac
ggaggaggggcacgagagttgaaggagcacatcttcttcaagggcatcgactggcagtat
gtgtacttacggaagtacccgccacccctaatccctcctcggggagaggtcaatgccgca
gacgcctttgatattggctcgtttgatgaagaagataccaaaggcattaagctgttggac
tgcgaccaggacctctataagaacttcccgctgatgatttctgagcgctggcagcaggaa
gtagtggagaccatctacgacgccgtcaatgccgaaactgataaaattgaggccaggaag
aaggctaaaaataaacagctttgtcaagaagaagattatgccatggggaaggactgcatc
atgcacggatacatgctgaagctggggaacccctttctcacacagtggcaaagacgttat
ttttacctgtttcccaacagactggagtggagaggagagggcgagtctcggcaaaatcta
ctgaccatggaacagatcatgtctgtggaggagacccaaattaaagacagaaaatgcatt
ttactcagggtaaaaggagggaagcagtttgttttgcaatgtgagagtgaccccgagttt
gcacagtggctgaaagagctgacgtgcaccttcaacgaggcccagagactgctgcgccgc
gcccccaagttcctcaacaaaccacgtgccgccatcctggagttctccaagccaccgctg
tgtcacagaaatagcagcggcctctga

DBGET integrated database retrieval system