KEGG   Rattus norvegicus (rat): 25374Help
Entry
25374             CDS       T01003                                 

Gene name
Alad, ALADR, aminolevulinatedelta-dehydratase
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    25374 (Alad)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     25374 (Alad)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   25374 (Alad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q32-q34
AA seq 330 aa AA seqDB search
MHHQSVLHSGYFHPLLRAWQTTPSTVSATNLIYPIFVTDVPDDVQPIASLPGVARYGVNQ
LEEMLRPLVEAGLRCVLIFGVPSRVPKDEQGSAADSEDSPTIEAVRLLRKTFPTLLVACD
VCLCPYTSHGHCGLLSENGAFLAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKA
ALLKHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGARGLALRAVAR
DIQEGADILMVKPGLPYLDMVQEVKDKHPELPLAVYQVSGEFAMLWHGAKAGAFDLRTAV
LESMTAFRRAGADIIITYFAPQLLKWLKEE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaccagtccgttctgcacagtggctactttcacccactgcttcgggcctggcag
accaccccctccaccgtcagtgccaccaacctcatctatcccatctttgtcacggatgtt
cctgatgatgtccagcccattgccagcctcccgggagtggccaggtatggcgtaaaccag
ctagaggagatgctgagacctctggtggaagccggccttcgctgtgtcctgatctttggc
gtccccagcagagttcccaaggatgaacagggctctgcagctgactcagaggactcccca
actattgaggctgtccgtctgctgaggaagaccttccctaccctcctagtggcctgtgat
gtctgcctgtgcccctacacctcccatggccactgtggcctcctgagtgaaaatggagcc
ttcctagcagaggaaagccgacaacggttggcagaggtggcactggcctatgccaaggca
ggttgtcaggttgtagctccatcagacatgatggatggacgagttgaagccatcaaggct
gccctgctaaaacatggacttggcaacagggtctctgtgatgagctatagtgccaaattt
gcctcctgtttctatggtcctttccgggatgcagctcagtcaagcccagctttcggagac
cgacgctgttatcagctgcctcctggagcccgtggcctggccctccgagcagtggcccgg
gacattcaagagggagctgacatactcatggtaaagccgggattaccctacctggatatg
gtgcaggaggtgaaggacaagcaccccgagctccccctcgcagtataccaggtgtccgga
gagtttgccatgttgtggcacggagccaaggctggggcctttgatctcaggactgctgta
ctggagtccatgacggccttccgcagagccggtgctgacattatcatcacctactttgca
ccccagctgttgaagtggctgaaggaagagtga

DBGET integrated database retrieval system