KEGG   Rattus norvegicus (rat): 25402Help
Entry
25402             CDS       T01003                                 

Gene name
Casp3, Lice, Yama
Definition
(RefSeq) caspase 3 (EC:3.4.22.56)
  KO
K02187  
caspase 3 [EC:3.4.22.56]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
p53 signaling pathway
Apoptosis
Apoptosis - multiple species
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Serotonergic synapse
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Pertussis
Legionellosis
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Herpes simplex infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Viral myocarditis
Module
Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    25402 (Casp3)
   04668 TNF signaling pathway
    25402 (Casp3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    25402 (Casp3)
   04215 Apoptosis - multiple species
    25402 (Casp3)
   04115 p53 signaling pathway
    25402 (Casp3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    25402 (Casp3)
  Nervous system
   04726 Serotonergic synapse
    25402 (Casp3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25402 (Casp3)
   05206 MicroRNAs in cancer
    25402 (Casp3)
   05205 Proteoglycans in cancer
    25402 (Casp3)
   05203 Viral carcinogenesis
    25402 (Casp3)
   05210 Colorectal cancer
    25402 (Casp3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    25402 (Casp3)
   05012 Parkinson's disease
    25402 (Casp3)
   05014 Amyotrophic lateral sclerosis (ALS)
    25402 (Casp3)
   05016 Huntington's disease
    25402 (Casp3)
  Cardiovascular diseases
   05416 Viral myocarditis
    25402 (Casp3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    25402 (Casp3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    25402 (Casp3)
  Infectious diseases
   05133 Pertussis
    25402 (Casp3)
   05134 Legionellosis
    25402 (Casp3)
   05152 Tuberculosis
    25402 (Casp3)
   05161 Hepatitis B
    25402 (Casp3)
   05168 Herpes simplex infection
    25402 (Casp3)
   05146 Amoebiasis
    25402 (Casp3)
   05145 Toxoplasmosis
    25402 (Casp3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     25402 (Casp3)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   25402 (Casp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
16q11
AA seq 277 aa AA seqDB search
MDNNETSVDSKSINNFETKTIHGSKSMDSGIYLDSSYKMDYPEMGLCIIINNKNFHKSTG
MSARNGTDVDAANLRETFMALKYEVRNKNDLTREEIMELMDSVSKEDHSKRSSFVCVILS
HGDEGVIFGTNGPVDLKKLTSFFRGDYCRSLTGKPKLFIIQACRGTELDCGIETDSGTDD
DMACQKIPVEADFLYAYSTAPGYYSWRNSRDGSWFIQSLCAMLKLYAHKLEFMHILTRVN
RKVATEFESFSLDATFHAKKQIPCIVSMLTKELYFYH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggacaacaacgaaacctccgtggattcaaaatccattaataattttgaaacaaagact
atccatggaagcaagtcgatggactctggaatatatctggacagcagttacaaaatggat
taccctgaaatgggcttgtgtataataattaataataagaacttccataaaagcactgga
atgtcagctcgcaatggtaccgatgtcgatgcagctaacctcagagagacattcatggcc
ctgaaatacgaagtcaggaataaaaatgaccttactcgtgaagaaattatggaattgatg
gatagtgtttctaaggaagatcacagcaaaaggagcagttttgtgtgtgtgattctaagt
catggagatgaaggagtaatttttggaacgaacggacctgtggacctgaaaaaactaact
agtttcttcagaggcgactactgccggagtctgactggaaagccgaaactcttcatcatt
caggcctgccgaggtacagagctggactgcggtattgagacagacagtggaactgacgat
gatatggcatgccagaagataccagtggaggccgacttcctgtatgcttactctaccgca
cccggttactattcctggagaaattcaagggacgggtcatggttcatccagtcactttgc
gccatgctgaaactgtacgcgcacaagctggaattcatgcacatcctcactcgtgttaac
cggaaggtggccacggaatttgagtccttctccctggacgccactttccatgcaaagaaa
cagatcccgtgtattgtgtcaatgctcacaaaagaactgtacttttatcactaa

DBGET integrated database retrieval system