KEGG   Rattus norvegicus (rat): 25403Help
Entry
25403             CDS       T01003                                 

Gene name
Cast
Definition
(RefSeq) calpastatin
  KO
K04281  
calpastatin
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q11
AA seq 713 aa AA seqDB search
MSRPGPKPAASSRPRRGAAASHTQEHVNEKNIGSSSKPAEKKGSDEVTASSAATGTSPRM
STTGAKAVKIESEKSQSSEPPVIHEKKPKGKPKEGSEPQTLPKHASDTGSKHAHKEKALS
RSNEQIVSEKSSESKTKFQDAPSADGESVAGGVTVATASDKVVVKKKEKKSLTPTLPMES
TLNKLSDKSGVNAALDDLIDTLGECEDTNKDDPPYTGPVVLDPMDSTYLEALGIKEGTIP
PEYRKLLEKNEAITGPLPDSPKPMGIDHAIDALSSDFTCSSPTGKQTEKEKSTGESSKAQ
SAGVTRSAVPPQEKKRKVEEEVMNDQALQALSDSLGTRQPDPQSHLRQAKQVKEAKAKEE
RQEKCGEDEDTVPAEYRLKPAKDKDGKPLLPEPEETSKCLSESELIGELSADFVQPTYQE
KPSMPAAKIKKGVVPDDAVETLARSLGTRKEDPEDEKSLVDKVKEKAKEEDHEKLGEKEE
TIPPDYRLEIVKDKDGKPLLPKEAEEQLPPLSDDFLLDALSQDFSSPANILSLGFEDAKL
SAAVSETVSQVPAPSNHTAAPPPGTERRDKELDDALDELSDSLGQRQPDPDENKPLDDKV
KEKIKAEHSEKLGERDDTIPPEYRHLLDNDGKDKPEKPLTKNTEKPGQDQDPIDALSEDL
DSCPPTTETSQNTTKEKGKKTSSSKASKNEEKTKDSSKKTEEVPKPKVDEDAT
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggcccggcccgaagcccgccgcctcttccaggccccggcgcggggcggcagct
agccacacccaggagcatgttaatgaaaagaatattggatcatcttctaaaccagcagaa
aagaaaggatctgatgaggtgacagcttcctctgctgccactggcacatctcccagaatg
agtaccacaggagctaaggctgtgaaaatagagtctgagaagtcacaatcaagtgagcca
cctgtgattcatgagaaaaagccaaaaggaaagccaaaggaagggtcagagccccaaact
cttcctaagcatgcatcagatacaggaagtaagcatgctcacaaagaaaaagcactttcc
agatcaaatgagcagatagtgtcagagaaatcatcagaatcaaagacaaaatttcaagat
gctccttctgctgatggagagagtgtggctggaggtgtgactgtggccactgcctcagac
aaggtggttgttaagaaaaaagagaagaaatcattaacacctactttacctatggagtcc
acactaaacaagctatctgacaagtcaggcgtgaatgctgctttggatgacctgatagac
accttaggtgaatgtgaagatactaacaaagatgatccaccatatactggaccagtagtt
ctggacccaatggattctacctaccttgaggcactgggtataaaagaagggactattcct
ccagagtataggaaacttctggagaaaaatgaagctatcacaggacctcttccagattct
cctaaacctatgggaatcgaccatgctatagatgccttgtcatctgatttcacctgtagc
tctccaactggaaagcaaactgagaaagagaagtctactggggaaagttcgaaagctcag
tctgcaggagtgaccagaagtgctgttcctccccaggagaagaaaaggaaagtagaagag
gaggtcatgaatgatcaagccctgcaggctctgtcagattcactgggcacccggcagcca
gaccctcagagccatcttaggcaagccaaacaagtcaaagaggcaaaagcaaaagaagaa
aggcaggagaaatgtggtgaagatgaggacacagtacctgctgagtacaggttaaaacca
gccaaggataaagatggaaaaccactattgccagaacctgaagaaacatctaagtgcctg
agtgagtcagagctgattggggagctttcagcagattttgtccaacctacatatcaagaa
aaaccatctatgccagctgcaaaaataaagaagggcgtagtgccagatgatgctgtagaa
accttggctagaagcctggggacaaggaaagaagatccagaagatgaaaaatctctggtg
gataaagtcaaggagaaagctaaagaagaagatcatgaaaaacttggtgaaaaagaagaa
acaattcctcctgattatcgactagaaatagtcaaggataaggatggaaaaccgctcctg
ccaaaagaagccgaggaacaacttccacccttaagcgatgacttccttcttgatgcattg
tctcaggacttctccagtcctgcaaacatattgtctcttggttttgaagatgccaaactt
tctgctgctgtttctgaaacagtttcccaggtgcctgctccaagcaaccacacagcagcc
ccaccgcctggcactgagaggagagacaaagaactcgatgatgccttggatgaactttct
gacagtcttggacaaagacagcctgatccagatgagaacaaaccactagatgataaagta
aaggaaaaaatcaaagcagagcatagcgagaaactgggagaaagagacgacaccatcccc
cctgaatataggcatctcctggataatgatgggaaggacaaaccagagaagccactgaca
aagaacacagagaagcctggtcaggaccaggaccccattgatgccctctcagaagacttg
gatagctgccccccaactacagagacttcacagaatacaacaaaggagaagggtaagaag
acttcaagttccaaagcatccaagaatgaagagaaaacaaaggattcctccaagaagaca
gaggaagtgcccaagccaaaggtggatgaagatgcaacataa

DBGET integrated database retrieval system