KEGG   Rattus norvegicus (rat): 25426Help
Entry
25426             CDS       T01003                                 

Gene name
Cyp1b1
Definition
(RefSeq) cytochrome P450, family 1, subfamily b, polypeptide 1
  KO
K07410  cytochrome P450 family 1 subfamily B polypeptide 1 [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00380  Tryptophan metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno04913  Ovarian steroidogenesis
rno05204  Chemical carcinogenesis
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    25426 (Cyp1b1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    25426 (Cyp1b1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    25426 (Cyp1b1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    25426 (Cyp1b1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    25426 (Cyp1b1)
   05204 Chemical carcinogenesis
    25426 (Cyp1b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     25426 (Cyp1b1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP1 family
   25426 (Cyp1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 25426
NCBI-ProteinID: NP_037072
RGD: 2460
Ensembl: ENSRNOG00000040287
Vega: OTTRNOG00000001278
UniProt: Q64678
Position
6q11
AA seq 543 aa AA seqDB search
MATSLSADSPQQLSSLSTQQTILLLLVSVLAIVHLGQWLLRQWRRKPWSSPPGPFPWPLI
GNAASVGRASHLYFARLARRYGDVFQIRLGSCPVVVLNGESAIHQALVQQGGVFADRPPF
ASFRVVSGGRSLAFGHYSERWKERRRAAYGTMRAFSTRHPRSRGLLEGHALGEARELVAV
LVRRCAGGACLDPTQPIIVAVANVMSAVCFGCRYNHDDAEFLELLSHNEEFGRTVGAGSL
VDVMPWLQLFPNPVRTIFREFEQINRNFSNFVLDKFLRHRESLVPGAAPRDMMDAFILSA
EKKATGDPGDSPSGLDLEDVPATITDIFGASQDTLSTALLWLLILFTRYPDVQARVQAEL
DQVVGRDRLPCMSDQPNLPYVMAFLYESMRFTSFLPVTLPHATTANTFVLGYYIPKNTVV
FVNQWSVNHDPAKWSNPEDFDPARFLDKDGFINKALASSVMIFSVGKRRCIGEELSKTLL
FLFISILAHQCNFKANQNEPSNMSFSYGLSIKPKSFKIHVSLRESMKLLDSAVEKLQAEE
ACQ
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccaccagccttagtgcagacagtccacagcagctgagctcgctgtctacccaacag
accattcttctgctactcgtttcggtcctggccatcgtgcacttaggccagtggctgctg
cgccagtggcgacggaaaccgtggtcctcgcccccgggtccctttccttggccattgatc
ggaaacgcggcgtctgttggccgggcatcgcacttgtacttcgctcgccttgcgaggcgc
tatggcgacgtttttcagatccgtctgggcagctgtcccgtggtggtgctgaatggcgag
agtgccatccatcaggctctggtgcagcagggcggcgtctttgcggaccggcctcccttc
gcctctttccgtgtggtgtctggtggccgcagcctggcgttcggccactactcagagcgc
tggaaggagcggcgacgtgcagcctatggcacgatgcgtgccttctccacccgccacccg
cgcagccgcggtctcctcgagggccacgcgctgggagaggctcgagagttggtggcagtg
ttggtgcggcgctgcgccggtggcgcctgcctcgatccgacgcagccgatcatagtggcg
gtggctaatgtcatgagcgctgtatgcttcggctgtcggtacaaccacgacgatgccgag
ttcctggagctgctcagccacaacgaggagttcgggcgcaccgtgggcgcgggcagcctg
gtggacgtgatgccctggctgcagctttttcccaacccggtgcgcaccatcttccgcgag
ttcgagcagatcaaccgcaacttcagcaacttcgtcctggacaagttcctgaggcaccga
gaaagcctcgtgcccggggctgctcctcgagacatgatggacgccttcatcctctccgcc
gaaaagaaggcgactggggaccctggtgacagtccctccgggctggatttggaggatgtg
cctgccactattacagacatctttggagccagccaggacaccctttccaccgcgctgctg
tggctgctcatcctctttaccagatacccggatgtgcaggcccgcgtgcaggccgagttg
gaccaggttgtggggagggaccgcctgccctgcatgagtgaccaacccaacttaccatac
gtcatggcttttctttatgaatccatgcgattcaccagctttttgcctgtcacccttcca
catgccaccactgccaacacctttgttttaggctactacatccccaaaaacacggtagtt
tttgttaaccagtggtctgtgaatcatgacccagcaaagtggtctaacccagaggacttt
gatccggcccgcttcctggacaaggacggcttcattaacaaggcactagccagcagcgtg
atgatattttcagtgggcaaacgacggtgcatcggcgaggagttgtctaagacgcttctg
tttctcttcatctccatcctcgctcatcagtgcaatttcaaggctaaccaaaacgagccc
tcaaacatgagtttcagttacggcctgagcattaagcccaagtcgtttaaaatccatgtg
tctctcagagagtccatgaagctccttgatagtgctgtcgagaagctgcaagctgaggaa
gcttgccagtga

DBGET integrated database retrieval system