KEGG   Rattus norvegicus (rat): 25435Help
Entry
25435             CDS       T01003                                 

Gene name
Eef2k, SMEF2K
Definition
eukaryotic elongation factor-2 kinase (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    25435 (Eef2k)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    25435 (Eef2k)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     25435 (Eef2k)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   25435 (Eef2k)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q35
AA seq 724 aa AA seqDB search
MADEDLIFRLEGVDGGGSSGAGRHGDSDTDSDDDEGYFICPITDDHMSNQNVNSKGQGYY
NNLLKTECGSTGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATEHATRHRYNAVT
GEWLKDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQHWKGASNYVAKRYLEPVDRSVY
FEDVQLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRQGQPLFHLEHYIEGKYIKYNS
NSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNLG
VRGMALFFYSHACNRICQSMGLAPFDLSPREQDAVNQSTKLLQSAKTILRGTEEKCGSPR
IRTLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFGDLDNM
GPRDHDRMDNHRDSENSGDSGYPSEKRSDLDDPEPREHGHSNGNRRPESDEDSLGSSGRV
CVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGKVHLAMVRYHEGGRFCE
KDEEWDQESAIFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLEETEENKTKGFDYL
LKAAEAGDRQSMILVARAFDTGLNLSPDRCQDWSEALHWYNTALETTDCDEGGEYDGIQD
EPQYALLAREAEMLLTGGFGLDKNPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAWA
QMEE
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttccgcctggaaggtgttgacggtggcgggtcctccgga
gctggccgccatggggactctgacacagacagtgacgatgatgagggctacttcatctgc
cccatcactgatgaccacatgtccaaccagaatgtcaactccaaaggccagggctactac
aacaacctactgaaaacggagtgtggctccacagggtcaccagccagctccttccacttc
aaggaggcctggaagcatgcgatcgagaaggccaagcacatgcccgacccctgggctgaa
ttccatctggaggacatcgccacagagcatgctactcggcacaggtacaatgctgtcacc
ggggagtggctgaaagacgaggttctgatcaagatggcatctcagcccttcggccgtgga
gcaatgagggagtgcttcaggacgaagaaactctccaacttcttgcatgcccagcattgg
aagggggcctccaactacgtggcaaaacgctacctcgagccagtggacaggagcgtgtac
tttgaggatgtgcagctccagatggaagcgaagctctggggggaggagtacaaccggcac
aagccccccaagcaggtagatatcatgcagatgtgcatcattgagctaaaggacagacaa
ggacagcccctcttccacctggagcactacattgagggcaagtacatcaagtataattcc
aactcaggctttgtccgtgatgacaacatcagactaacaccacaggccttcagccatttc
acatttgaacgttctggtcatcagctgattgtagtggacatccagggtgtgggcgacctt
tatactgacccacagatccacactgagaaaggcactgactttggagatggtaaccttggt
gtccggggaatggctctcttcttctactctcatgcctgcaaccgtatttgccagagcatg
ggccttgcgccctttgacctctccccacgggagcaggatgccgtgaaccagagcaccaag
ctgttgcaatcagccaagaccatcttgagggggacagaggagaagtgtgggagtccccgc
ataaggacactctctggcagccggccccccttgctccttcgcctgtcagagaactctggg
gatgagaacatgagtgatgtgacctttgactctctgccttcctccccgtcttcagccaca
ccacacagccagaagttggaccacctccattggccagtgtttggtgacctcgataacatg
ggccctagagaccatgaccgcatggacaatcaccgggactctgagaatagtggggacagt
gggtatccaagcgagaagcgaagtgacctggatgatcctgagccccgagaacacggccac
tccaatggcaaccgaaggcctgaatctgatgaggacagcctgggcagctctggacgggtc
tgtgtggagacgtggaacctgctcaatccctcccgcctgcacctgcccaggccctcggcc
gtggccctagaagtgcaaaggttaaatgctctggaccttggaaggaaaatcgggaagtct
gttttggggaaggtccatctggccatggtacggtaccacgagggcgggcgcttctgcgag
aaggatgaggaatgggatcaagagtctgccatcttccatctggagcatgcagccgacctg
ggagaactggaggccatcgtgggcctaggcctcatgtactctcagctgccccaccacatc
ctggctgatgtctctctggaggagacagaagagaacaagacaaaaggctttgattacctc
ctgaaggccgcagaagctggtgacaggcagtccatgattttagtggctcgagcttttgac
accggcctgaacctcagcccagacaggtgtcaagactggtcggaagccttacactggtac
aacacggccctggagacgacggactgcgatgaaggcggggagtatgacggaatacaggac
gagccccagtatgcactgctggccagggaggcagagatgttgctcaccggtggatttgga
ctggacaagaacccccaaagatcaggagacttgtacacccaggcagccgaggcagcaatg
gaagccatgaagggccggctagccaaccagtactatgagaaggcggaagaggcctgggcg
caaatggaggaataa

DBGET integrated database retrieval system