KEGG   Rattus norvegicus (rat): 25435Help
Entry
25435             CDS       T01003                                 

Gene name
Eef2k, SMEF2K
Definition
eukaryotic elongation factor-2 kinase (EC:2.7.11.20)
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
rno  Rattus norvegicus (rat)
Pathway
Oxytocin signaling pathway
Class
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:rno04921]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q35
AA seq 724 aa AA seqDB search
MADEDLIFRLEGVDGGGSSGAGRHGDSDTDSDDDEGYFICPITDDHMSNQNVNSKGQGYY
NNLLKTECGSTGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATEHATRHRYNAVT
GEWLKDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQHWKGASNYVAKRYLEPVDRSVY
FEDVQLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRQGQPLFHLEHYIEGKYIKYNS
NSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNLG
VRGMALFFYSHACNRICQSMGLAPFDLSPREQDAVNQSTKLLQSAKTILRGTEEKCGSPR
IRTLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFGDLDNM
GPRDHDRMDNHRDSENSGDSGYPSEKRSDLDDPEPREHGHSNGNRRPESDEDSLGSSGRV
CVETWNLLNPSRLHLPRPSAVALEVQRLNALDLGRKIGKSVLGKVHLAMVRYHEGGRFCE
KDEEWDQESAIFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLEETEENKTKGFDYL
LKAAEAGDRQSMILVARAFDTGLNLSPDRCQDWSEALHWYNTALETTDCDEGGEYDGIQD
EPQYALLAREAEMLLTGGFGLDKNPQRSGDLYTQAAEAAMEAMKGRLANQYYEKAEEAWA
QMEE
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagacctcatcttccgcctggaaggtgttgacggtggcgggtcctccgga
gctggccgccatggggactctgacacagacagtgacgatgatgagggctacttcatctgc
cccatcactgatgaccacatgtccaaccagaatgtcaactccaaaggccagggctactac
aacaacctactgaaaacggagtgtggctccacagggtcaccagccagctccttccacttc
aaggaggcctggaagcatgcgatcgagaaggccaagcacatgcccgacccctgggctgaa
ttccatctggaggacatcgccacagagcatgctactcggcacaggtacaatgctgtcacc
ggggagtggctgaaagacgaggttctgatcaagatggcatctcagcccttcggccgtgga
gcaatgagggagtgcttcaggacgaagaaactctccaacttcttgcatgcccagcattgg
aagggggcctccaactacgtggcaaaacgctacctcgagccagtggacaggagcgtgtac
tttgaggatgtgcagctccagatggaagcgaagctctggggggaggagtacaaccggcac
aagccccccaagcaggtagatatcatgcagatgtgcatcattgagctaaaggacagacaa
ggacagcccctcttccacctggagcactacattgagggcaagtacatcaagtataattcc
aactcaggctttgtccgtgatgacaacatcagactaacaccacaggccttcagccatttc
acatttgaacgttctggtcatcagctgattgtagtggacatccagggtgtgggcgacctt
tatactgacccacagatccacactgagaaaggcactgactttggagatggtaaccttggt
gtccggggaatggctctcttcttctactctcatgcctgcaaccgtatttgccagagcatg
ggccttgcgccctttgacctctccccacgggagcaggatgccgtgaaccagagcaccaag
ctgttgcaatcagccaagaccatcttgagggggacagaggagaagtgtgggagtccccgc
ataaggacactctctggcagccggccccccttgctccttcgcctgtcagagaactctggg
gatgagaacatgagtgatgtgacctttgactctctgccttcctccccgtcttcagccaca
ccacacagccagaagttggaccacctccattggccagtgtttggtgacctcgataacatg
ggccctagagaccatgaccgcatggacaatcaccgggactctgagaatagtggggacagt
gggtatccaagcgagaagcgaagtgacctggatgatcctgagccccgagaacacggccac
tccaatggcaaccgaaggcctgaatctgatgaggacagcctgggcagctctggacgggtc
tgtgtggagacgtggaacctgctcaatccctcccgcctgcacctgcccaggccctcggcc
gtggccctagaagtgcaaaggttaaatgctctggaccttggaaggaaaatcgggaagtct
gttttggggaaggtccatctggccatggtacggtaccacgagggcgggcgcttctgcgag
aaggatgaggaatgggatcaagagtctgccatcttccatctggagcatgcagccgacctg
ggagaactggaggccatcgtgggcctaggcctcatgtactctcagctgccccaccacatc
ctggctgatgtctctctggaggagacagaagagaacaagacaaaaggctttgattacctc
ctgaaggccgcagaagctggtgacaggcagtccatgattttagtggctcgagcttttgac
accggcctgaacctcagcccagacaggtgtcaagactggtcggaagccttacactggtac
aacacggccctggagacgacggactgcgatgaaggcggggagtatgacggaatacaggac
gagccccagtatgcactgctggccagggaggcagagatgttgctcaccggtggatttgga
ctggacaagaacccccaaagatcaggagacttgtacacccaggcagccgaggcagcaatg
gaagccatgaagggccggctagccaaccagtactatgagaaggcggaagaggcctgggcg
caaatggaggaataa

DBGET integrated database retrieval system