KEGG   Rattus norvegicus (rat): 25473Help
Entry
25473             CDS       T01003                                 

Gene name
Lamb2, SLAM
Definition
laminin, beta 2
Orthology
K06243  
laminin, beta 2
Organism
rno  Rattus norvegicus (rat)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    25473 (Lamb2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    25473 (Lamb2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    25473 (Lamb2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    25473 (Lamb2)
   05222 Small cell lung cancer
    25473 (Lamb2)
  Infectious diseases
   05146 Amoebiasis
    25473 (Lamb2)
   05145 Toxoplasmosis
    25473 (Lamb2)
Cell adhesion molecules and their ligands [BR:rno04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      25473 (Lamb2)
   VLA-6
      25473 (Lamb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8
AA seq 1801 aa AA seqDB search
MEWASGKPGRGRQGQPVPWELRLGLLLSVLAATLAQVPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWRVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHSHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDMRDPAACRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASNPRGCQRCQCNSRGT
VPGGTPCDSSSGTCFCKRLVTGDGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCPCRPHMIGRRCEQVQPGYFRPFLDHLTWEAEGAHGQVLEVVERLVTNRETPSWTGV
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELVVQRPGPVSAHSPCGHV
LPRDDRIQGMLHPNTRVLVFPRPVCLEPGLSYKLKLKLTGTGGRAHPETPYSGSGILIDS
LVLQPHVLMLEMFSGGDAAALERRTTFERYRCHEEGLMPSKTPLSEACVPLLISASSLVY
NGALPCQCDPQGSLSSECNPHGGQCRCKPGVVGRRCDACATGYYGFGPAGCQACQCSPDG
ALSALCEGTSGQCLCRTGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDAHTGACLGCR
DYTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCHCR
AGYTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPTDPGACDPHTGQCLRCLHHTEGP
HCGHCKPGFHGQAARQSCHRCTCNLLGTDPQRCPSTDLCHCDPSTGQCPCLPHVQGLSCD
RCAPNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELHWGDPG
LQCRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDW
DRVVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNLQGKLGMVQAIVAARNTSAASTAK
LVEATEGLRHEIGKTTERLTQLEAELTDVQDENFNANHALSGLERDGLALNLTLRQLDQH
LDILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAIPSPVSNSADTRRRAEVLMGAQRE
NFNRQHLANQQALGRLSTHTHTLSLTGVNELVCGAPGDAPCATSPCGGAGCRDEDGQPRC
GGLGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDK
ANASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLAS
EIAERVRSLADVDTILAHTMGDVRRAEQLLQDAQRARSRAEGERQKAETVQAALEEAQRA
QGAAQGAIRGAVVDTKNTEQTLQQVQERMAGTEQSLNSASERARQLHALLEALKLKRAGN
SLAASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDE
ARGLLQAAQDKLQRLQELEGTYEENERELEVKAAQLDGLEARMRSVLQAINLQVQIYNTC
Q
NT seq 5406 nt NT seq  +upstreamnt  +downstreamnt
atggagtgggcctcaggaaaaccagggaggggcaggcagggacagcctgtgccatgggaa
cttcgcttgggcctacttctaagtgtgctggctgccacattggcccaagtcccatccttg
gatgtacctggctgttctcgaggaagctgctatccagccaccggtgacctgttggtgggc
cgtgcagacagactgacagcctcctccacgtgtggcttgcatagccctcaaccctactgt
attgtcagtcacctgcaggatgaaaagaagtgcttcctgtgtgactcccgacgtcccttc
tctgctcgagacaacccaaatagtcaccggatccagaatgtagtcactagctttgcgcca
caacgccggacggcctggtggcagtcggagaacggtgttccgatggtcaccatccaactg
gacctggaagctgagtttcatttcacccacctcatcatgaccttcaagacatttcgtcct
gcggccatgctggtggagcgctctgcagacttcggccgcacgtggcgtgtctaccgatat
ttttcctacgactgcggggctgacttcccaggaatcccgctggccccgccgcgtcgctgg
gatgatgtagtgtgtgagtcccgctactcagaaattgagccatctactgaaggcgaggtc
atctatcgtgtgctggatcctgctattcctattccagacccctacagctcacggattcag
aacctgttgaagatcaccaacctccgtgtgaacctcacccggcttcacacactgggagac
aacttgcttgacccacggcgggagatccgggaaaaatattattatgctctctatgaactt
gtcatccgcgggaactgcttctgctatggacatgcctcacagtgtgcgcctgcaccaggg
gcaccggcccatgctgagggcatggtacatggggcctgtatttgcaagcacaatactcgt
gggctcaactgtgagcagtgtcaggatttctatcaggaccttccctggcatcctgctgag
gatggccatactcacgcctgtcggaagtgtgagtgcaacgggcatagtcatagctgccac
tttgacatggctgtgtacctggcatctggaaacgtaagtggaggtgtctgcgatggctgt
cagcacaacacggctgggcgccactgcgagctctgccggcccttcttctaccgtgaccca
accaaggacatgcgggatccagctgcgtgccgtccttgtgactgtgacccaatgggttct
caagacggtggccgctgtgattcccatgatgaccctgtgctaggtctggtctcaggccag
tgtcgctgcaaagaacacgtggttggcactcgctgccagcaatgccgggacggcttcttt
ggacttagtgccagcaaccctcgaggatgtcagcgttgtcagtgtaactcaaggggcaca
gtgcctgggggcaccccttgtgactccagtagtggaacctgtttctgcaagcgtctggtg
actggagacggctgtgaccgctgtctgcctggccactggggcctgagccatgacctgcta
ggctgccgcccctgtgactgtgatgtgggcggtgccttggatcctcagtgtgatgaagcc
acgggtcagtgcccgtgccgcccacacatgattgggcggcgctgtgaacaagtacagcct
ggctacttccggccttttctagaccatctaacctgggaggctgagggtgcccatgggcag
gtgcttgaggtggtagaacgtctggtgaccaaccgagagactccgtcctggactggtgta
ggctttgtgcgactgcgggaaggtcaggaagtggagttcctggtgacctctttgcctagg
gccatggactatgacctgctactgcgctgggagccccaggttcctgagcagtgggcagag
ctggaattggtggtgcagcgcccagggcctgtgtctgcacacagtccgtgtgggcacgtg
ctgccgagggatgaccgcattcaggggatgcttcacccaaacaccagggttttggtgttt
cccagacctgtctgccttgagcctggtctctcctacaagctgaagttgaaattgactgga
acagggggacgtgcccatcctgaaaccccatactctggatctggaatactcattgactcg
ctggtgctgcagccccatgtcttgatgctagagatgtttagtgggggggatgctgctgcc
ctggaacgccgtaccacctttgaacgctaccgctgccatgaggaaggtctgatgcccagc
aagacccccctatctgaggcctgcgttcccctcctcatcagtgcgtcctccctggtctac
aatggcgccttgccctgccagtgtgaccctcaaggctcactgagttccgaatgcaatcct
catggtggccagtgccggtgcaagcctggagtggttggacgacgctgtgatgcctgtgct
actggctactatggctttgggcccgcaggctgtcaagcctgccagtgtagtcccgacgga
gcactcagtgccctgtgtgaagggactagtggacagtgtctctgccgaaccggtgccttt
ggtcttcgctgtgaccactgtcaacgtggccagtggggtttccctaactgccggccgtgt
gtctgcaacgggcgtgcagatgagtgtgacgcccacacaggcgcttgcctgggctgccgt
gattacacagggggcgagcactgtgagaggtgcattgctggttttcatggggacccacgg
ctgccatatgggggccagtgccggccttgtccctgccctgaaggccccgggagccagcga
cactttgctacttcatgtcaccgggatggatattcccagcaaattgtgtgccactgtcga
gcaggctacacagggcttcggtgtgaggcttgtgcccccgggcactttggggacccatcc
aagccaggtggcaggtgccaactgtgtgagtgcagtgggaacattgaccccacggatccc
ggtgcctgtgatccccacacggggcaatgcttgcgctgtttacaccacacggaggggccc
cactgtggccattgcaagcctggcttccatgggcaagctgcccgacagagctgtcaccgc
tgtacctgcaaccttctgggcacagatccccagcggtgcccatctacagacctgtgccat
tgtgacccaagcactgggcagtgcccatgcctcccccatgtccaaggcctcagttgcgac
cgttgtgcccccaacttttggaactttaccagtggacgtggctgccagccttgtgcttgt
cacccaagccgggccagaggccctacctgcaatgagttcacagggcagtgccactgtcat
gctggctttggtgggaggacctgttctgagtgccaagagctccactggggagaccctgga
ctgcagtgccgcgcctgtgactgtgatcccagaggaatagacaaaccccaatgtcatcgt
tctactggtcactgtagctgccgcccaggcgtgtctggcgtgcgctgcgaccagtgtgct
cgtggcttctcgggtgtttttcctgcttgtcacccctgccatgcatgctttggagactgg
gatcgtgtggtacaggaccttgctgctcgtacgcggcgcctggagcagtgggctcaggaa
ttgcagcaaacgggtgtgctgggtgcctttgagagcagctttttaaacctgcaggggaag
ctgggaatggtgcaggccatcgtggctgcccgcaacacctcagctgcgtctactgcaaag
cttgtagaggccacagagggactgcgtcatgaaattgggaagaccactgaacgcctgact
cagttagaagcagagctcacagatgtacaggatgagaacttcaatgccaaccatgcactc
agtggtctggagagagacgggctcgcacttaatctcacactgaggcagcttgaccagcat
ctggatatcctcaaacactcaaatttcttaggtgcctatgacagcatccgacatgcccac
agtcagtctacagaagcagagcgccgggccaatgcctccacctttgcaatacccagccct
gtgagcaactcagcagatacccggcgtcgggcagaagtgctaatgggtgcccaaagagag
aacttcaaccgccagcacttggccaaccagcaggcacttggacggctgtccacacacacc
cataccctgagcctgacgggagtaaatgagctggtgtgtggggccccaggggacgcaccc
tgtgctaccagcccttgtgggggtgctggatgtcgggatgaggatgggcaaccccgctgt
ggtggcctcggttgcagtggagcagcagccacagcagatctagcactgggccgggctcgg
cacacacaggcagagctgcagagagcgctggtagaaggtggtggcatcctcagccgagtg
tctgagactcgtcggcaggcagaggaggcccagcaacgagcacaggcagccctggacaag
gctaatgcttctaggggccaagtggagcaggccaatcaggagcttcgagaacttatccag
aatgtgaaggacttcctcagccaggagggagctgatcccgacagtattgaaatggtagca
acacgggtgctagacatctccatcccagcctcgcctgagcagatccagcgcctagcaagt
gagattgcagaacgtgtccgaagcctggcggatgtggacacaatcctggcacataccatg
ggggatgtgcgtcgggctgaacagctactgcaagatgcacagcgggcacggagccgggct
gagggtgagagacagaaggcagagacagtccaagcggcactggaggaggcccagagggca
cagggagctgctcagggcgccatccggggagcagtggttgacacaaaaaacacagagcag
accctgcagcaggtccaggagaggatggcaggtacagagcagtctctgaactctgctagt
gagcgggctcggcagttacatgcccttctggaagccctgaaactgaaaagggcaggaaac
agcctggcagcatctacagctgaagagacagcaggcagtgcccagagccgtgccagggag
gctgagaaacagctacgggaacaagtaggtgaccagtaccaaactgtgagggcgttggct
gaacggaaggctgaaggtgttctggccgcacaagccagagcagaacaactgcgggatgag
gctcggggtctgttgcaggctgctcaggacaagttgcagcggctacaggaactggagggc
acatatgaagagaatgaacgcgaactggaggtcaaagcggctcagctggatgggctggag
gccaggatgcgcagtgtgcttcaggcaatcaacctgcaggtccagatctacaacacctgc
cagtga

DBGET integrated database retrieval system