KEGG   Rattus norvegicus (rat): 25506Help
Entry
25506             CDS       T01003                                 

Gene name
P4hb, PDI, PDIR
Definition
prolyl 4-hydroxylase, beta polypeptide (EC:5.3.4.1)
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    25506 (P4hb)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     25506 (P4hb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   25506 (P4hb)
  Exosomal proteins of colorectal cancer cells
   25506 (P4hb)
  Exosomal proteins of bladder cancer cells
   25506 (P4hb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.3
AA seq 508 aa AA seqDB search
MLSRALLCLALAWAARVGADALEEEDNVLVLKKSNFAEPAAHNYLLVEFYAPWCGHCKAL
APEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAG
READDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDAGSDSAKQFLLAAEAV
DDIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEITKEKLLDFIKHNQLPLVIE
FTEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKKAAEGFKGKILFIFIDSDHTDNQ
RILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKITQFCHHFLEGKIKPHLMSQE
LPEDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHEN
IVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAG
DNDDLDLEEALEPDMEEDDDQKAVKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctgagccgtgctttgctgtgcctggccctggcctgggcggctagggtgggcgccgac
gctctggaggaggaggacaacgtcctggtgctgaagaagagcaacttcgcagagccggcg
gcgcacaactacctgctggtggagttctatgccccatggtgtggccactgcaaagcactg
gccccagagtatgccaaagctgctgcaaaactgaaggcagaaggctctgagatccgacta
gcaaaggtggacgccacagaagagtctgacctggcccagcagtatggtgtccgtggctac
cccacaatcaagttcttcaagaatggagacacagcctccccaaaggaatatacagctggc
agggaagctgacgacattgtgaactggctgaagaaacgcacaggcccagcagccacaacc
ctgtctgacactgcagctgcagagtccttggtggactcaagcgaagtgacggtcatcggc
ttcttcaaggacgcagggtcagactccgccaagcagttcttgctggcagcagaggctgtt
gatgacataccttttggaatcacttccaatagcgatgtgttttccaagtaccagctggac
aaggatggggtggtcctctttaagaagtttgatgaaggccgcaacaattttgaaggtgag
atcaccaaggagaagctattagacttcatcaagcacaaccagctgcctttggtcatcgag
ttcactgaacagacagctccaaagattttcggaggtgaaatcaagacacatattctgctg
ttcctgcccaagagtgtgtctgactacgatggcaaattgagcaactttaagaaagcggcc
gagggctttaagggcaagatcctgttcatcttcatcgatagtgaccacactgacaaccag
cgcatacttgagttctttggcctgaagaaggaggaatgtccagctgtgcggcttattacc
ctggaggaagagatgaccaagtacaaaccggagtcagacgagctgacagctgagaagatc
acacaattttgccaccacttcctggagggcaagatcaagccccacctgatgagccaggaa
ctgcctgaagactgggacaagcagccagtgaaagtgctagttgggaaaaactttgaggag
gttgcttttgatgagaaaaagaacgtgtttgttgaattctatgctccctggtgtggtcac
tgcaagcagctagccccgatttgggataaactgggagagacatacaaagaccatgagaat
atcgtcatcgctaagatggactcaacagccaatgaggtggaagctgtgaaggtgcacagc
tttcccacactcaagttcttcccagcaagtgcagacagaacggtcattgattacaacggt
gagcggacactagatggttttaagaaattcttggagagcggtggccaggatggagcgggg
gacaatgacgacctcgacctagaagaagctttagagccagatatggaagaagacgacgat
cagaaagccgtgaaggatgaactgtag

DBGET integrated database retrieval system