KEGG   Rattus norvegicus (rat): 25514Help
Entry
25514             CDS       T01003                                 

Gene name
Lypla1, 25KDL, Pla1a
Definition
lysophospholipase I (EC:3.1.1.5)
Orthology
K06128  
lysophospholipase I [EC:3.1.1.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rno00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q12
AA seq 230 aa AA seqDB search
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMP
VTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQ
GGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLM
FGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaacaacatgtccgccccgatgcccgccgttgtgcccgccgcccggaaggcc
accgccgcggttattttccttcacggattgggagatactgggcacggatgggcagaagcc
ttcgcaggtatcaaaagttcccacatcaaatacatctgtccacatgcgcctgttatgcca
gtcacactaaacatgagtatgatgatgccttcttggtttgatattattggactttcacca
gattcccaggaggatgaatctggaattaagcaggcggcagaaactgtaaaagccttgata
gatcaagaagtgaagaatggcattccttctaacagaattattttgggaggattttctcag
ggaggcgccttatctttatacactgctctcaccacacagcagaaactggctggtgtcact
gcactcagttgctggcttccacttcgggcttcgttttcacaggggcctatcaatagtgct
aatcgagatatttctgttctccagtgtcatggagactgtgaccctttagttcccctaatg
tttggttctcttactgttgaaagactaaaaggattggtaaatccagccaatgtaaccttc
aaagtctatgaaggcatgatgcacagctcatgtcagcaggaaatgatggatgtcaagtac
ttcattgataagctcctacctccaattgattga

DBGET integrated database retrieval system