KEGG   Rattus norvegicus (rat): 25523Help
Entry
25523             CDS       T01003                                 

Gene name
Prkg2, GDPKII, cGKII
Definition
protein kinase, cGMP-dependent, type II (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    25523 (Prkg2)
 Cellular Processes
  Cell communication
   04540 Gap junction
    25523 (Prkg2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    25523 (Prkg2)
  Digestive system
   04970 Salivary secretion
    25523 (Prkg2)
  Nervous system
   04730 Long-term depression
    25523 (Prkg2)
  Sensory system
   04740 Olfactory transduction
    25523 (Prkg2)
  Environmental adaptation
   04713 Circadian entrainment
    25523 (Prkg2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     25523 (Prkg2)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   25523 (Prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p22
AA seq 762 aa AA seqDB search
MGNGSVKPKHSKHPDGQSGNLSNEALRSKVAELEREVKRKDAELQEREYHLKELREQLAK
QTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRG
AKAGVSAEPTSRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIVKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRS
MSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENIAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacccaagcattcgaagcacccagacggccagtcagggaac
ctcagcaatgaagccctgcggagcaaagtggcagagctggagcgcgaggtgaagaggaag
gatgcagaacttcaggagcgcgagtaccacctgaaggagcttcgggagcagctagctaag
cagaccgtggccattgcggagctcaccgaggagctgcagagcaagtgcatccagctgaac
aagctgcaggatgttatccacgtgcagggaggaagcccactgcaggcctctcccgacaaa
gtgcctctggatgttcaccgcaagacctcaggcttggtctccctccacagcaggaggggg
gcgaaggctggagtgtctgcagagcccacaagccggacctatgacctcaacaagccccct
gagttctcctttgagaaagcgagggtcaggaaggattccagtgagaaaaaacttatcaca
gacgccctgaataagaaccagtttctgaagagactggatccgcagcagatcaaagacatg
gtggaatgcatgtacgggagaaactatcaacagggcagttacatcgttaagcaaggggaa
cctggaaaccacatctttgtgctggccgagggtagactggaggtgttccaaggagagaaa
ttgctgtcgtccatcccaatgtggaccacgtttggggagctggctattttgtataattgt
acgcggactgcctctgtgaaagctattaccaatgttaaaacttgggctctcgatagagag
gttttccagaacattatgaggagaacagcgcaagccagggatgaggaatacagaaacttc
ctcagaagtgtctccttgttgaagaatttacctgaagacaaactaaccaagattattgac
tgcttggaagtggaatactatgacaaaggagattatatcatcagagaaggagaggaaggg
agcacctttttcatcttggcaaaaggaaaggtgaaagtcacacagagcacagagggccat
gatcagccacagttgatcaaaacactgcagaaaggagagtactttggagaaaaggctctg
atcagtgatgatgtcagatcggccaatataatcgcggaagaaaatgatgtcgcatgcctc
gtgatcgaccgagaaacattcaaccaaactgtcgggacatttgatgaactccaaaaatac
cttgaggggtatgtggccaccctgaaccgtgacgatgaaaagagacacgcaaagcgctcc
atgtctagctggaagttgtccaaagccctttctctggagatgattcagctgaaagagaag
gtggccagattctcctcaacctccccattccagaaccttgagattatcgcaacactgggc
gttggtgggttcggaagagtggagcttgttaaagttaaaaatgagaacatcgcttttgcc
atgaagtgtataaggaagaagcacattgttgacactaaacagcaggaacatgtctactcc
gagaagaggatcctggaggagctgtgttctcccttcatcgtgaaattgtatcgtactttc
aaggacaataaatacgtatacatgcttctggaggcctgcttaggtggggagctctggagt
atattaagggacagaggcagcttcgatgaacccacctccaaattctgtgtggcctgcgtg
acagaagcattcgattatctacaccgactaggcattatctacagagacctgaagccagag
aacttaattctggatgccgatggctaccttaagttggttgactttggattcgctaagaag
attggctctgggcagaaaacgtggacattctgtgggactccagagtatgtggcccccgag
gtcattcttaacaaaggacatgacttcagtgtggatttctggtccctggggattctggtc
tatgagcttctaacgggcaaccctcccttttctgggatagaccaaatgatgacctacaat
ttgattctcaaagggatcgagaaaatggattttcctagaaagataacaaggcgacccgag
gatttgatccggaggctttgcaggcaaaacccaacagaaaggctggggaacctgaagaat
gggatcaacgacattaagaaacacaggtggttaaacggtttcaattgggaggggttgaaa
gcacggagccttccctcacctttacgaagagagctcagtggccccatagatcacagctac
tttgacaagtatcctcctgaaaagggggttcctccggatgaaatgtcaggctgggataag
gacttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system